BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20525 (445 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476,936... 31 0.31 03_02_0752 - 10922456-10922644,10922719-10922796,10922888-109230... 30 0.73 01_01_0158 + 1374169-1374324,1374464-1375295,1375977-1376242 29 1.3 12_02_0335 - 17669232-17670063,17670619-17672150 27 6.8 01_01_0136 + 1237623-1237820,1238313-1239001,1239978-1240308,124... 27 6.8 10_08_0322 + 16736013-16736072,16737200-16737305,16737436-167375... 27 9.0 01_01_0137 + 1249081-1249341,1249500-1250237 27 9.0 >06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476, 9366267-9366428,9367151-9367235,9367352-9367501, 9367588-9367635,9367705-9367773,9367897-9368600, 9369426-9369561,9369636-9369856,9370355-9370486, 9371316-9371406,9371878-9371925,9372004-9372132, 9372357-9372626 Length = 897 Score = 31.5 bits (68), Expect = 0.31 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 8 CVSQNTGTCPESSCACPEISCACPETSCACPESSC 112 C GTC E C CP++ C C C +S C Sbjct: 661 CPCLTNGTCCEKYCGCPKM-CKNRFRGCHCAKSQC 694 >03_02_0752 - 10922456-10922644,10922719-10922796,10922888-10923016, 10923105-10923152,10923243-10923333,10923517-10923648, 10923869-10924086,10925121-10925271,10925360-10926009, 10926715-10926786,10926938-10926985,10927105-10927242, 10927750-10927756,10928064-10928212 Length = 699 Score = 30.3 bits (65), Expect = 0.73 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 8 CVSQNTGTCPESSCACPEISCACPETSCACPESSC 112 C GTC E C C + SC C C +S C Sbjct: 464 CACVENGTCCEKYCGCSK-SCKNRFRGCHCAKSQC 497 >01_01_0158 + 1374169-1374324,1374464-1375295,1375977-1376242 Length = 417 Score = 29.5 bits (63), Expect = 1.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 11 VSQNTGTCPESSCACPEISCACPETSCA 94 ++++ TCP + C CPE C S A Sbjct: 116 ITEHEKTCPHAPCFCPEPGCGFAAASAA 143 >12_02_0335 - 17669232-17670063,17670619-17672150 Length = 787 Score = 27.1 bits (57), Expect = 6.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 26 GTCPESSCACPEISCACPETSC 91 G C ESSC +C +TSC Sbjct: 581 GPCAESSCISSSCQPSCAQTSC 602 >01_01_0136 + 1237623-1237820,1238313-1239001,1239978-1240308, 1240614-1241351 Length = 651 Score = 27.1 bits (57), Expect = 6.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 11 VSQNTGTCPESSCACPEISCACPETSCACP 100 V+ + CP + C+CPE C + A P Sbjct: 465 VADHQRACPCAPCSCPEPGCRFRSSPAALP 494 >10_08_0322 + 16736013-16736072,16737200-16737305,16737436-16737584, 16738344-16738596,16738928-16739037,16739302-16739376, 16739477-16739563,16739754-16739840,16740021-16740158, 16740438-16740503 Length = 376 Score = 26.6 bits (56), Expect = 9.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 126 VWGQRQLLSGQAQLVSGQAQLISGQAQLLSGQV 28 +WGQ + +A LVS Q + Q + +G+V Sbjct: 131 LWGQGDVRFDEADLVSDQGETSQAQVEATTGEV 163 >01_01_0137 + 1249081-1249341,1249500-1250237 Length = 332 Score = 26.6 bits (56), Expect = 9.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 26 GTCPESSCACPEISCACPETSC 91 G E ACP C+CP+ C Sbjct: 143 GAAAEHQRACPCAPCSCPDPGC 164 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,732,028 Number of Sequences: 37544 Number of extensions: 46671 Number of successful extensions: 223 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 215 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 847740284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -