BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20521 (737 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) 40 0.003 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 34 0.10 SB_56374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_43049| Best HMM Match : DUF947 (HMM E-Value=4) 33 0.24 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 33 0.32 SB_17268| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.7) 33 0.32 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 33 0.32 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 32 0.42 SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) 31 0.74 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_364| Best HMM Match : Tim17 (HMM E-Value=0.45) 31 1.3 SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 30 1.7 SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) 30 1.7 SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) 30 1.7 SB_48008| Best HMM Match : M (HMM E-Value=0.0068) 30 1.7 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_23458| Best HMM Match : MCPVI (HMM E-Value=1.4) 30 2.3 SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) 29 3.0 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_21688| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) 29 3.9 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 29 3.9 SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) 29 3.9 SB_3881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 29 5.2 SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) 29 5.2 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 29 5.2 SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16) 29 5.2 SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) 29 5.2 SB_26625| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 29 5.2 SB_59554| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) 28 6.9 SB_52772| Best HMM Match : rve (HMM E-Value=0.001) 28 6.9 SB_50440| Best HMM Match : SOUL (HMM E-Value=1.7) 28 6.9 SB_50296| Best HMM Match : TP2 (HMM E-Value=9.8) 28 6.9 SB_50235| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) 28 6.9 SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) 28 6.9 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 28 6.9 SB_43260| Best HMM Match : Gemini_mov (HMM E-Value=0.94) 28 6.9 SB_43173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_41471| Best HMM Match : Cupin_4 (HMM E-Value=0.31) 28 6.9 SB_40442| Best HMM Match : zf-MYM (HMM E-Value=2.7) 28 6.9 SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 28 6.9 SB_37598| Best HMM Match : TrbF (HMM E-Value=0.3) 28 6.9 SB_37178| Best HMM Match : fn3 (HMM E-Value=4.7e-08) 28 6.9 SB_33182| Best HMM Match : rve (HMM E-Value=0.00043) 28 6.9 SB_27883| Best HMM Match : TrbF (HMM E-Value=1.5) 28 6.9 SB_23918| Best HMM Match : rve (HMM E-Value=0.013) 28 6.9 SB_20408| Best HMM Match : rve (HMM E-Value=0.0034) 28 6.9 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) 28 6.9 SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) 28 6.9 SB_11351| Best HMM Match : LRV (HMM E-Value=6) 28 6.9 SB_10207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_3288| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_1077| Best HMM Match : rve (HMM E-Value=2.1e-17) 28 6.9 SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) 28 6.9 SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) 28 6.9 SB_48686| Best HMM Match : rve (HMM E-Value=1.2e-19) 28 6.9 SB_46070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) 28 6.9 SB_39575| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 28 6.9 SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) 28 6.9 SB_32880| Best HMM Match : rve (HMM E-Value=3.4e-05) 28 6.9 SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_24923| Best HMM Match : rve (HMM E-Value=1.5e-11) 28 6.9 SB_24601| Best HMM Match : DUF934 (HMM E-Value=1.5) 28 6.9 SB_18590| Best HMM Match : FYVE (HMM E-Value=8.8e-29) 28 6.9 SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_13182| Best HMM Match : Pox_A32 (HMM E-Value=0.033) 28 6.9 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 28 6.9 SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 28 6.9 SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_1527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_308| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_58199| Best HMM Match : DUF1388 (HMM E-Value=0.0002) 28 9.1 SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) 28 9.1 SB_46803| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_24737| Best HMM Match : KID (HMM E-Value=0.096) 28 9.1 SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) 28 9.1 SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) 28 9.1 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 28 9.1 SB_41679| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.7) 28 9.1 SB_39788| Best HMM Match : Ricin_B_lectin (HMM E-Value=6.4e-14) 28 9.1 SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 28 9.1 >SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) Length = 299 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/68 (32%), Positives = 37/68 (54%) Frame = +1 Query: 304 IRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEV 483 I EQ +E + KME +EKR++Y+ L++RL + VE+ R T+E+ Sbjct: 189 IAQEQIEQQSKLIEEKIMQKMEMTKEKRDSYMEALKTRLHEKSLDVEQKRQTMEEIQMFQ 248 Query: 484 YKAIEDKM 507 K +E+K+ Sbjct: 249 RKILEEKL 256 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 4/70 (5%) Frame = +3 Query: 540 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQ--AADRRLL--IEAEQREKLRN 707 K+ E+L +E V+ V+A Q ++ +EKLQQ AA + ++ + + + EKL+ Sbjct: 119 KETQEKLLAKDEHVKTVQAQAQVMAEEHSKVTEEKLQQKFAASKEIIEELRSAKEEKLQA 178 Query: 708 HNIKLAEVRS 737 H ++ +S Sbjct: 179 HERRVRVAQS 188 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 552 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQ 653 E+L+ HE +VR ++ QE+ +Q I+EK+ Q Sbjct: 174 EKLQAHERRVRVAQSIAQEQIEQQSKLIEEKIMQ 207 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/66 (31%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Frame = +3 Query: 534 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKL--QQAADRRLLIEAEQ-REKLR 704 +L+ M+E+ R+ E++ K+ +++K QQLE+ +Q K Q A+ ++ E EQ R++ + Sbjct: 1231 DLQSMVEQDRQRAERMEKLALEHEKKVQQLETELQSKSSGQGGANEAIIKEMEQLRQEQQ 1290 Query: 705 NHNIKL 722 ++ KL Sbjct: 1291 DYQHKL 1296 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 34.3 bits (75), Expect = 0.10 Identities = 21/66 (31%), Positives = 35/66 (53%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 710 E L+++ E RE+ EQ+RK+ + K Q+ E +E+ +Q ++ IE E+R Sbjct: 1264 EELRRLQEE-REYREQMRKIAEARERKLQEEE---EERRRQEEEQLRAIEEERRRLQEEE 1319 Query: 711 NIKLAE 728 KL E Sbjct: 1320 ERKLRE 1325 >SB_56374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 483 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 549 IERLRE-HEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKL 701 IE+L++ HEE++ + + ++E +QEKL+ RR +E E+ E+L Sbjct: 422 IEQLKKKHEEEMAEFEKAQELNKTRVEQGLQEKLRARRSRRRKMEVEKAEEL 473 >SB_43049| Best HMM Match : DUF947 (HMM E-Value=4) Length = 209 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/53 (28%), Positives = 34/53 (64%) Frame = +3 Query: 540 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREK 698 K++ ++ REH+E++RK+ +K++Q+E L + RR ++E +++E+ Sbjct: 150 KRIDDKNREHQEELRKLNEEQNDKYEQVEIDCIVALNE---RRKILERQRQER 199 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/59 (27%), Positives = 33/59 (55%) Frame = +1 Query: 337 ATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTQ 513 + KE +M T +EK + + ++L+D L K++ Q+ +E Y+A++++M Q Sbjct: 423 SNKEKEYKRMATEQEKESKSLRKKNNQLEDELTNQGKSKEQEAQEHSEKYEALKNEMQQ 481 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/72 (22%), Positives = 41/72 (56%) Frame = +1 Query: 301 RIRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAE 480 R ++ Q + + ++ + + + H EK EA NE++ + K+ L+ +++ +E++ E Sbjct: 444 RKKNNQLEDELTNQGKSKEQEAQEHSEKYEALKNEMQQQGKEWLKQDKESHKQIEEREKE 503 Query: 481 VYKAIEDKMTQL 516 K++ D++ +L Sbjct: 504 C-KSLRDEVRKL 514 >SB_17268| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.7) Length = 434 Score = 32.7 bits (71), Expect = 0.32 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = +3 Query: 534 NLKKMIERLREHEEQVRKVRAGNQEKFQQLE----SAIQEKLQQAADRRLLIEAEQREKL 701 N +K R EH+ V K+ + +FQQ +A QE+ + RR ++E E++ L Sbjct: 325 NAQKRRMRQLEHKRAVEKLIEDRRMQFQQEREAELAARQEEERMEMYRRQIVEQERQRLL 384 Query: 702 RNHNIKL 722 R H KL Sbjct: 385 REHATKL 391 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/67 (23%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAAD-RRLLIEAEQREKLRN 707 + L K+ ++ +E ++ ++ + Q F+ ++ L+++ + ++L E REKL+N Sbjct: 1039 KELDKVKQQKKEMKKSFKRSKGDLQNSFENERKQFEDSLEKSKEVGKMLAEEVMREKLKN 1098 Query: 708 HNIKLAE 728 IK E Sbjct: 1099 ETIKYEE 1105 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 32.3 bits (70), Expect = 0.42 Identities = 17/54 (31%), Positives = 33/54 (61%) Frame = +3 Query: 537 LKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREK 698 LK+M ++ + +E+ K + +EK ++ EK ++ +++LLIE E+REK Sbjct: 898 LKEMKDKEKIEKEKREKDKREREEKERKRRQQQLEKEKKEKEKKLLIEKEKREK 951 >SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 31.9 bits (69), Expect = 0.56 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +1 Query: 337 ATKEALDAKMETHEEKREAYINELRSRLKDHLEG-VEKTRLTLEQQTAEV 483 A ++AL+A +E R+ + ELR ++ + E +E+ R+ E+Q AE+ Sbjct: 52 AIRDALNAAEAKAQEDRKQALEELRKKMNEEREQCLEQARIRAEEQMAEI 101 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 31.5 bits (68), Expect = 0.74 Identities = 16/60 (26%), Positives = 33/60 (55%) Frame = +3 Query: 552 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEV 731 ER++E E+ +K++ QEK +L + + L++ +R+ +E E K + +KL + Sbjct: 302 ERIKEEVEKQKKIKLEQQEK--ELRDKLLKNLKEMKERKQELERELLRKQIKNKVKLNSI 359 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 31.5 bits (68), Expect = 0.74 Identities = 12/49 (24%), Positives = 32/49 (65%) Frame = +3 Query: 552 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREK 698 ERLR+ EE+ + +++ + + ++++ ++ +RRL++E ++RE+ Sbjct: 1444 ERLRKEEEERKMEEERRRDEQARRDKELEDQKRKDEERRLIMEQQERER 1492 >SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) Length = 301 Score = 31.5 bits (68), Expect = 0.74 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 530 REPQEDDRASART*GTSSQSPRR*PGEVPAARERHPGEAAAGRR 661 +EP + R ART + +P R P A HPG AGRR Sbjct: 22 QEPGKPAREPARTPVAALPAPARVTSPEPPATRPHPGRVEAGRR 65 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 31.1 bits (67), Expect = 0.97 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 6/124 (4%) Frame = +3 Query: 345 GGARRQDG-DPRGKTRGLHQRAALPSQGSS*GR*EDQVDPGTADRGSVQ---GHXXXXXX 512 GG RR+D D G+ RG +R S+ R E++ + ADR + Sbjct: 1006 GGYRRRDEEDTIGRVRGRRERGESRSREEI-MREEEERERREADRRREEERIAEQKRRDD 1064 Query: 513 XXXXXXENLKKMIE--RLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAE 686 E ++ +E R RE E + +VR +E+ ++ E + E+ + +RR E E Sbjct: 1065 EERLRREEEERRLEEERRREEERKREEVRRLEEERKREEERRLAEQRRVEEERRRKEEEE 1124 Query: 687 QREK 698 QR + Sbjct: 1125 QRRR 1128 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 31.1 bits (67), Expect = 0.97 Identities = 15/42 (35%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +3 Query: 531 ENLKKMIER-LREHEEQVRKVRAGNQEKFQQLESAIQEKLQQ 653 E K++I + L EE++ +VR Q+K +QLE+ ++E+ Q+ Sbjct: 2276 ERDKQLISKELEAKEEELEEVRYSMQKKIKQLEAQLEEEYQE 2317 >SB_364| Best HMM Match : Tim17 (HMM E-Value=0.45) Length = 437 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/60 (35%), Positives = 26/60 (43%) Frame = +2 Query: 482 CTRPSKIR*HSCRQA*REPQEDDRASART*GTSSQSPRR*PGEVPAARERHPGEAAAGRR 661 C +P+ S A QE ART S+ R E PA R +HPG+ GRR Sbjct: 9 CAQPAGTANGSAEPADEHHQEAAHEPART--PSALVERITSPEPPATRPKHPGQVETGRR 66 >SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 1353 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 5/66 (7%) Frame = +2 Query: 467 SRPRKCTRP-----SKIR*HSCRQA*REPQEDDRASART*GTSSQSPRR*PGEVPAARER 631 SR K ++P S+ R SC+ +PQ+ D+ S R S ++ + P + AAR+ Sbjct: 877 SRKTKTSKPQHKQASRPRHASCKTMASKPQDQDKQSTRPGQKSRKTRTKKPQDKQAARQS 936 Query: 632 HPGEAA 649 P +A+ Sbjct: 937 RPRQAS 942 >SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) Length = 1805 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/58 (24%), Positives = 34/58 (58%) Frame = +1 Query: 343 KEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTQL 516 +E ++ T E EA +++L + EG+ +++++L++ +E++ +EDK +L Sbjct: 447 QEDIERHQLTKERLHEA-VSDLLELTRGETEGLRESQISLDENWSELWALLEDKEEEL 503 >SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) Length = 1558 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/59 (27%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQE--KFQQLESAIQEKLQQAADRRLLIEAEQREKL 701 EN+ K E L++ +E+ + E + ++ ++A++E + A + + +E +QREKL Sbjct: 1261 ENMAKFSENLKKEQERTKAALRERLEARRKKKKDAAMKEITKAAKEEKEALEQQQREKL 1319 >SB_48008| Best HMM Match : M (HMM E-Value=0.0068) Length = 1068 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/67 (25%), Positives = 39/67 (58%), Gaps = 2/67 (2%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAE--QREKLR 704 ++L+ ++ LREHE +++K +E+ LE + E L + + ++ + E+ ++E++ Sbjct: 564 DSLEADVKILREHESELKKEMTSLKERNHNLEQMLNELLAKDSGQQTVGESSPARQEEIN 623 Query: 705 NHNIKLA 725 + KLA Sbjct: 624 RISRKLA 630 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 578 SSQSPRR*PGEVPAARERHPGEAAAGRR 661 ++ P R P E PA R +HPG AGRR Sbjct: 1060 TAHEPARTP-EPPATRPKHPGRVEAGRR 1086 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Frame = +3 Query: 531 ENLKKMIERLREHEE---QVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKL 701 E ++++E RE EE Q + G QEK ++L+ ++ +L++ +++ I E L Sbjct: 341 EAQRRILEDRREVEEIEQQAAEQLKGQQEKEEELKRLLERQLEEEKEKKEYIRREAERLL 400 Query: 702 RNHNI 716 R + Sbjct: 401 REERL 405 >SB_23458| Best HMM Match : MCPVI (HMM E-Value=1.4) Length = 770 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PAAR +HPG AGRR Sbjct: 225 EPPAARPKHPGRVEAGRR 242 >SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) Length = 359 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/49 (22%), Positives = 32/49 (65%) Frame = +3 Query: 552 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREK 698 ERLR+ +E+ + +++ + + ++++ ++ +RRL++E ++RE+ Sbjct: 258 ERLRKEKEERKMEEERRRDEQARRDRELEDQQRKDEERRLIMEQQERER 306 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQRE 695 E L K+ + L + +++ V+ + KFQ+ ++ QEK L+ QR+ Sbjct: 707 EALTKVSKELEQTNQELENVKCSMEGKFQENQNVFQEKCAALRKEEELVNKLQRQ 761 >SB_21688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1078 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 534 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRR 668 N++KM+E R+ + K+R N F Q +A Q L ++ R Sbjct: 225 NVQKMLENSRQENSRTLKIRGQNSAFFSQQLTAFQVWLAMGSEMR 269 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 603 QEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAE 728 QEK Q+L+ AI+EK ++ +R +E ++++K+ K E Sbjct: 751 QEKTQRLKYAIEEKAKKERERMEQLEIQRQKKVEEQKKKREE 792 >SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) Length = 440 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/54 (24%), Positives = 29/54 (53%) Frame = +1 Query: 349 ALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMT 510 AL K + + +N+ +L + +EG++ T +TL+QQ ++ + + + T Sbjct: 235 ALQKKYSDELKSSQDELNDFVIQLDEEVEGMQSTIMTLQQQIKDIKQRLATETT 288 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/46 (30%), Positives = 29/46 (63%) Frame = +3 Query: 564 EHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKL 701 EHE + ++ ++E+ QQL + + K++ + RL + +EQR+K+ Sbjct: 61 EHESVLDTLKKSHEEEMQQLIAETKNKIEYFKN-RLGVVSEQRQKI 105 >SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) Length = 635 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG+ AGRR Sbjct: 554 EPPATRPKHPGQVKAGRR 571 >SB_3881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG+ AGRR Sbjct: 254 EPPATRPKHPGQVEAGRR 271 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/47 (29%), Positives = 29/47 (61%) Frame = +3 Query: 558 LREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREK 698 L++ + Q ++ R Q++ QQL+ Q++LQQ ++L + QR++ Sbjct: 1498 LQQQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQRQR 1544 >SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) Length = 988 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +2 Query: 530 REPQEDDRASART*GTSSQSPRR*PGEVPAARERHPGEAAAGRR 661 +EP + R ART + + R P A HPG AGRR Sbjct: 797 QEPGKQRREPARTPVAALPAAARVTSPEPPATRPHPGRVEAGRR 840 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 28.7 bits (61), Expect = 5.2 Identities = 17/52 (32%), Positives = 32/52 (61%) Frame = +1 Query: 361 KMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTQL 516 +ME+ +EK E+ + ELR++L D LE + T +E++ E+ E ++ +L Sbjct: 118 EMESEQEKHESELEELRAQL-DKLENSD-TESLVEERMKELKANYEREVEEL 167 >SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG+ AGRR Sbjct: 803 EPPATRPKHPGQIEAGRR 820 >SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 187 EPPATRPKHPGRVGAGRR 204 >SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16) Length = 814 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/47 (29%), Positives = 29/47 (61%) Frame = +3 Query: 558 LREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREK 698 L++ + Q ++ R Q++ QQL+ Q++LQQ ++L + QR++ Sbjct: 152 LQQQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQRQR 198 >SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) Length = 942 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 295 PPRSWPSSEQWRPSTSFQATSP 230 PP S P+S Q+ PS+SF A P Sbjct: 107 PPASHPNSAQYPPSSSFGANMP 128 >SB_26625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 542 EDDRASART*GTSSQSPRR*PGEVPAARERHPGEAAAGRR 661 E D+ +A +SP E PA R +HPG AGRR Sbjct: 154 EPDKQAAEQTAHEPRSP-----EPPATRPKHPGRVEAGRR 188 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +1 Query: 343 KEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTA 477 K+ D+ E H+E ++ + E K H+E ++ T + +EQQ A Sbjct: 1422 KKVQDSSNEIHKENQD--LREELKMAKRHIESLKSTLIQVEQQAA 1464 >SB_59554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1247 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 636 EPPATRPKHPGRVEAGRR 653 >SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) Length = 1020 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 570 EPPATRPKHPGRVEAGRR 587 >SB_52772| Best HMM Match : rve (HMM E-Value=0.001) Length = 646 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 87 EPPATRPKHPGRVEAGRR 104 >SB_50440| Best HMM Match : SOUL (HMM E-Value=1.7) Length = 437 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 168 EPPATRPKHPGRVEAGRR 185 >SB_50296| Best HMM Match : TP2 (HMM E-Value=9.8) Length = 278 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 186 EPPATRPKHPGRVEAGRR 203 >SB_50235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 501 EPPATRPKHPGRVEAGRR 518 >SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) Length = 937 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 687 EPPATRPKHPGRVEAGRR 704 >SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) Length = 624 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 472 EPPATRPKHPGRVEAGRR 489 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 961 EPPATRPKHPGRVKAGRR 978 >SB_43260| Best HMM Match : Gemini_mov (HMM E-Value=0.94) Length = 294 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 46 EPPATRPKHPGRVEAGRR 63 >SB_43173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 502 EPPATRPKHPGRVEAGRR 519 >SB_41471| Best HMM Match : Cupin_4 (HMM E-Value=0.31) Length = 406 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLL--IEAEQREKLR 704 + L+ +++R ++ E + R V+ N+E + ++EK Q+A + L I+ EQ EK + Sbjct: 297 QELRDILKREKD-EAKARAVKRKNEEVTRLRNERLEEKRQEALRKLELERIQKEQEEKAK 355 Query: 705 NHNI 716 + Sbjct: 356 REQV 359 >SB_40442| Best HMM Match : zf-MYM (HMM E-Value=2.7) Length = 235 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 98 EPPATRPKHPGRVEAGRR 115 >SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 1144 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 832 EPPATRPKHPGRVKAGRR 849 >SB_37598| Best HMM Match : TrbF (HMM E-Value=0.3) Length = 419 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 48 EPPATRPKHPGRVEAGRR 65 >SB_37178| Best HMM Match : fn3 (HMM E-Value=4.7e-08) Length = 961 Score = 28.3 bits (60), Expect = 6.9 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESA-IQEKLQQAADRRLLIEAEQREKLRN 707 E++ MIER EEQV+++ +E+ Q+E A + E+ + + R E+ +++ R+ Sbjct: 187 EDIDLMIER---EEEQVKQLTKAYREELTQIEKAFVTERSELIENNRKKWESSMQQR-RD 242 Query: 708 HNIKLAEVR 734 ++ E R Sbjct: 243 KEVEYMEAR 251 >SB_33182| Best HMM Match : rve (HMM E-Value=0.00043) Length = 801 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_27883| Best HMM Match : TrbF (HMM E-Value=1.5) Length = 389 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_23918| Best HMM Match : rve (HMM E-Value=0.013) Length = 1785 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 1204 EPPATRPKHPGRVEAGRR 1221 >SB_20408| Best HMM Match : rve (HMM E-Value=0.0034) Length = 887 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 357 EPPATRPKHPGRVKAGRR 374 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 1218 EPPATRPKHPGRVEAGRR 1235 >SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) Length = 1178 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 620 EPPATRPKHPGRVKAGRR 637 >SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) Length = 1667 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 1086 EPPATRPKHPGRVEAGRR 1103 >SB_11351| Best HMM Match : LRV (HMM E-Value=6) Length = 194 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_10207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1105 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 777 EPPATRPKHPGRVEAGRR 794 >SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 294 EPPATRPKHPGRVEAGRR 311 >SB_3288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 58 EPPATRPKHPGRVEAGRR 75 >SB_1077| Best HMM Match : rve (HMM E-Value=2.1e-17) Length = 794 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 211 EPPATRPKHPGRVEAGRR 228 >SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) Length = 353 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 189 EPPATRPKHPGRVEAGRR 206 >SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) Length = 1141 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 1018 EPPATRPKHPGRVEAGRR 1035 >SB_48686| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 722 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 294 EPPATRPKHPGRVEAGRR 311 >SB_46070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -1 Query: 581 NLFLMFAQTLDHLLEVLV-TLVGSCVI 504 NLF+ QT++HLL V V L G CVI Sbjct: 17 NLFIDSKQTMNHLLYVSVGVLAGMCVI 43 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 769 EPPATRPKHPGRVEAGRR 786 >SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) Length = 2074 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 2007 EPPATRPKHPGRVEAGRR 2024 >SB_39575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1411 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 1204 EPPATRPKHPGRVEAGRR 1221 >SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1608 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 976 EPPATRPKHPGRVEAGRR 993 >SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) Length = 625 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 463 EPPATRPKHPGRVEAGRR 480 >SB_32880| Best HMM Match : rve (HMM E-Value=3.4e-05) Length = 1264 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 781 EPPATRPKHPGRVEAGRR 798 >SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 1513 EPPATRPKHPGRVEAGRR 1530 >SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 851 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 690 EPPATRPKHPGRVEAGRR 707 >SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1035 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 385 EPPATRPKHPGRVEAGRR 402 >SB_24923| Best HMM Match : rve (HMM E-Value=1.5e-11) Length = 1445 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 1023 EPPATRPKHPGRVEAGRR 1040 >SB_24601| Best HMM Match : DUF934 (HMM E-Value=1.5) Length = 343 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 38 EPPATRPKHPGRVEAGRR 55 >SB_18590| Best HMM Match : FYVE (HMM E-Value=8.8e-29) Length = 551 Score = 28.3 bits (60), Expect = 6.9 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 5/84 (5%) Frame = +1 Query: 340 TKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTA--EVYKAI---EDK 504 +K K+E+ +E ++ INEL + + EG+++ E++ + E+ K + EDK Sbjct: 26 SKNLYAKKLESEKELQD-KINELNTEISSLQEGMQELGTIAEKEISLDEMQKCLEEKEDK 84 Query: 505 MTQLPXXXXXXXXXXXXXCANMRN 576 +TQL C + +N Sbjct: 85 LTQLQRRVEVLEAELKKECESCKN 108 >SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 553 EPPATRPKHPGRVEAGRR 570 >SB_13182| Best HMM Match : Pox_A32 (HMM E-Value=0.033) Length = 745 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 433 EPPATRPKHPGRVEAGRR 450 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +1 Query: 298 SRIRSEQTNNFIVATK-EALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQT 474 SR+ SE + I K + +A +E ++K + INE R +L++ ++ ++ + Sbjct: 1455 SRLNSELEDALIDLEKAQTNNANLEKKQKKIDIQINEWRVKLEEVQADLDNSQKEARNYS 1514 Query: 475 AEVYK 489 E+YK Sbjct: 1515 TEMYK 1519 >SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 1152 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 788 EPPATRPKHPGRVKAGRR 805 >SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 217 EPPATRPKHPGRVEAGRR 234 >SB_1527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 809 EPPATRPKHPGRVEAGRR 826 >SB_674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -1 Query: 581 NLFLMFAQTLDHLLEVLV-TLVGSCVI 504 NLF+ QT++HLL V V L G CVI Sbjct: 17 NLFIDSKQTMNHLLYVSVGVLAGMCVI 43 >SB_308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 608 EVPAARERHPGEAAAGRR 661 E PA R +HPG AGRR Sbjct: 5 EPPATRTKHPGRVEAGRR 22 >SB_58199| Best HMM Match : DUF1388 (HMM E-Value=0.0002) Length = 638 Score = 27.9 bits (59), Expect = 9.1 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 530 REPQEDDRASART*GTSSQSPRR*PGEVPAARERHPG--EAAAGRRPTS 670 R P A RT GT + R PG V +A+ R PG ++A R P++ Sbjct: 398 RTPSTVKSAQVRTPGTVKSAQVRTPGTVKSAQVRTPGTVKSAQVRTPST 446 >SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) Length = 1266 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 606 EKFQQLESAIQEKLQQAADRRLLIEAE-QREKLRNHNIKL 722 EKF+Q+ESA Q K + RR L+ E + +L + KL Sbjct: 786 EKFRQIESAYQSKDPEGELRRRLLRLEDENTELHEYATKL 825 >SB_46803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 27.9 bits (59), Expect = 9.1 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 530 REPQEDDRASART*GTSSQSPRR*PGEVPAARERHPG--EAAAGRRPTS 670 R P A RT GT + R PG V +A+ R PG ++A R P++ Sbjct: 35 RTPSTVKSAQVRTPGTVKSAQVRTPGTVKSAQVRTPGTVKSAQVRTPST 83 >SB_24737| Best HMM Match : KID (HMM E-Value=0.096) Length = 636 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 379 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDK 504 E RE I++L LKD + + TLEQ A++ + +E K Sbjct: 148 EDREKSIDKLEKELKDQEAKHNRQKNTLEQTVAKMKEVMERK 189 >SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) Length = 1183 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/51 (21%), Positives = 35/51 (68%) Frame = +3 Query: 540 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQR 692 +++ L++HEE+VR+++ ++ ++++ A++E++ + R +++E+R Sbjct: 213 RQLENMLKDHEEEVRRMKEERKDLCEEIK-ALREEVNEFKARVSHLKSEER 262 >SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) Length = 516 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +2 Query: 575 TSSQSPRR*PGEVPAARERHPGEAAAGRR--PTSA 673 T SQ+ +R P ++ ++ PG AAGRR P SA Sbjct: 476 TGSQAGKRTPKKMDKVKKASPGSRAAGRRTNPPSA 510 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/68 (16%), Positives = 41/68 (60%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 710 E+ ++ +ER ++ +++ ++ + ++ Q++++ ++++ Q+ RR+ IE ++ E + Sbjct: 74 EHKQRGLERSKQEAQRLLALQEQHLKEEQEIKNEVEKERQEEEKRRMEIEKQRMESEKKR 133 Query: 711 NIKLAEVR 734 ++ + R Sbjct: 134 ILESKQKR 141 >SB_41679| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.7) Length = 78 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/53 (24%), Positives = 29/53 (54%) Frame = +1 Query: 358 AKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTQL 516 +K+ H+E + IN+L + + L+ + +L+Q E ++ DK+++L Sbjct: 2 SKVNGHKETVDKAINDLSEKFNESLQRMNNKISSLQQVLHEKRSSMADKISEL 54 >SB_39788| Best HMM Match : Ricin_B_lectin (HMM E-Value=6.4e-14) Length = 784 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/62 (25%), Positives = 33/62 (53%) Frame = +1 Query: 331 IVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMT 510 +VA K + +K+ H+E + IN+L + + L+ + +L Q E ++ DK++ Sbjct: 530 LVARKNSR-SKVNGHKETVDKAINDLSEKFNESLQRMNNKISSLHQVLHEKRSSMADKIS 588 Query: 511 QL 516 +L Sbjct: 589 EL 590 >SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 9.1 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +1 Query: 316 QTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEK--TRLTLEQQTAEVYK 489 QT I+ E ME + + E EL +L+ K T+L L Q+TAE YK Sbjct: 401 QTQILILQVHEDYRKLMEQKQAEEERCRKELEEKLQTLERDSHKYRTKLELAQKTAETYK 460 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/68 (16%), Positives = 41/68 (60%) Frame = +3 Query: 531 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 710 E+ ++ +ER ++ +++ ++ + ++ Q++++ ++++ Q+ RR+ IE ++ E + Sbjct: 192 EHKQRGLERSKQEAQRLLALQEQHLKEEQEIKNEVEKERQEEEKRRMEIEKQRMESEKKR 251 Query: 711 NIKLAEVR 734 ++ + R Sbjct: 252 ILESKQKR 259 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,333,419 Number of Sequences: 59808 Number of extensions: 304421 Number of successful extensions: 1551 Number of sequences better than 10.0: 104 Number of HSP's better than 10.0 without gapping: 1350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1550 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -