BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20518 (407 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 24 1.9 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 24 1.9 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 1.9 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 4.3 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 23 4.3 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 23 4.3 AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 23 5.7 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 22 7.5 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 22 9.9 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 24.2 bits (50), Expect = 1.9 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 27 GHKVIITSEPLKLEFLDQNGEIAVVLNENSQLLVEPLRARREKVED--EDGDGANQLDDE 200 G V T L+ E+ G A + + L + AR K D E+GD + Sbjct: 13 GQTVAYTIPALRFEYPTMRGFRASI-PDTPGLQMFAFHARLNKPFDQFEEGDYTEDVTAP 71 Query: 201 EGTWSETFQSHHDSKPRGT 257 +G TF ++ + P GT Sbjct: 72 DGDGRWTFDTNKPALPNGT 90 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.2 bits (50), Expect = 1.9 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 27 GHKVIITSEPLKLEFLDQNGEIAVVLNENSQLLVEPLRARREKVED--EDGDGANQLDDE 200 G V T L+ E+ G A + + L + AR K D E+GD + Sbjct: 13 GQTVAYTIPALRFEYPTMRGFRASI-PDTPGLQMFAFHARLNKPFDQFEEGDYTEDVTAP 71 Query: 201 EGTWSETFQSHHDSKPRGT 257 +G TF ++ + P GT Sbjct: 72 DGDGRWTFDTNKPALPNGT 90 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 24.2 bits (50), Expect = 1.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 24 QGHKVIITSEPLKLEFLDQNGEIAVVLNEN 113 Q K++ ++ LKLE + EI V NEN Sbjct: 893 QRDKLLKQNDELKLEIKKKENEITKVRNEN 922 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 4.3 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 27 GHKVIITSEPLKLEFLDQNGEIAVVLNENSQLLVEPLRARREKVED--EDGDGANQLDDE 200 G V T ++ E+ G A + + L + AR K D E+GD + Sbjct: 13 GQTVAYTIPAVRFEYPTMRGFRASI-PDTPGLQMFAFHARLNKPFDQFEEGDYTEDVTAP 71 Query: 201 EGTWSETFQSHHDSKPRGT 257 +G TF ++ + P GT Sbjct: 72 DGDGRWTFDTNKPALPNGT 90 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 4.3 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 27 GHKVIITSEPLKLEFLDQNGEIAVVLNENSQLLVEPLRARREKVED--EDGDGANQLDDE 200 G V T ++ E+ G A + + L + AR K D E+GD + Sbjct: 13 GQTVAYTIPAVRFEYPTMRGFRASI-PDTPGLQMFAFHARLNKPFDQFEEGDYTEDVTAP 71 Query: 201 EGTWSETFQSHHDSKPRGT 257 +G TF ++ + P GT Sbjct: 72 DGDGRWTFDTNKPALPNGT 90 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 4.3 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +3 Query: 27 GHKVIITSEPLKLEFLDQNGEIAVVLNENSQLLVEPLRARREKVED--EDGDGANQLDDE 200 G V T ++ E+ G A + + L + AR K D E+GD + Sbjct: 13 GQTVAYTIPAVRFEYPTMRGFRASI-PDTPGLQMFAFHARLNKPFDQFEEGDYTEDVTAP 71 Query: 201 EGTWSETFQSHHDSKPRGT 257 +G TF ++ + P GT Sbjct: 72 DGDGRWTFDTNKPALPNGT 90 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 22.6 bits (46), Expect = 5.7 Identities = 13/48 (27%), Positives = 18/48 (37%) Frame = +3 Query: 165 EDGDGANQLDDEEGTWSETFQSHHDSKPRGTKQFRSTLSSLMRITSTV 308 +DGD + DDEE F + +P + S R TV Sbjct: 40 DDGDYVQKNDDEEDIVDSDFSIDENDEPISDAEEEPAKGSKRRKVGTV 87 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 22.2 bits (45), Expect = 7.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 178 GLISWMMRKELGVRPSSPITTPNLGARSS 264 GLIS E G R S+P +P ARSS Sbjct: 1434 GLISRWRDMEEGGRQSTPPASPARLARSS 1462 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 21.8 bits (44), Expect = 9.9 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 105 NENSQLLVEPLRARREKVEDEDGDGANQLDDEEG 206 N NS R RR +ED G N++ + G Sbjct: 125 NRNSDPRPATGRKRRRIIEDSASPGVNKIVNSRG 158 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 396,085 Number of Sequences: 2352 Number of extensions: 7362 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -