BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20517 (509 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 27 0.15 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.1 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 1.8 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 23 2.4 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 23 2.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 3.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 3.2 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 4.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 7.4 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 7.4 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 9.8 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 26.6 bits (56), Expect = 0.15 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 258 KIPDWFLNRQKDIVDGKYSQLTSSNLDSKLRED-LERLKKI 377 KI WFL++ K+I+D Y L +++ +L D L R K+I Sbjct: 275 KIDKWFLHKMKNIID-YYLVLENTDHTKQLSHDVLLRAKQI 314 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 285 QKDIVDGKYSQLTSSNLDSKLREDLERLKKIRA 383 + D + QLTSS +S + D +LK IRA Sbjct: 1781 ESDESESDPDQLTSSRTESSNQLDAGKLKHIRA 1813 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 285 QKDIVDGKYSQLTSSNLDSKLREDLERLKKIRA 383 + D + QLTSS +S + D +LK IRA Sbjct: 1777 ESDESESDPDQLTSSRTESSNQLDAGKLKHIRA 1809 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/47 (21%), Positives = 24/47 (51%) Frame = -1 Query: 263 YLICLGFDMIVIIFSTSSSVHSPARLSRSMSAFLRTMLEYLRPTPLI 123 ++ +G M+V IF ++ S+ +P+ L A ++ + P++ Sbjct: 64 FVSAMGNGMVVYIFLSTKSLRTPSNLFVINLAISNFLMMFCMSPPMV 110 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 22.6 bits (46), Expect = 2.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 103 PFVCHRCSYS 74 PF C +CSYS Sbjct: 16 PFKCEKCSYS 25 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 133 VGRRYSNIVLKKADIDLDKRAGECTEEEVEKIITI 237 +G+R S V K A T +E+EKI T+ Sbjct: 3 LGQRISGAVAVLRGTSEVKEAQTSTSDEIEKITTV 37 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 3.2 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -1 Query: 260 LICLGFDMIVIIFSTSSSVHSPARLSRSMSAFLRTMLEYLRPTPLIAVIAN 108 ++C+ MI I F+TS ++ R + + T+ L PT ++ A+ Sbjct: 540 MLCIPGYMIYIWFTTSGTISEKFRKLIRIEDDVATLRMKLNPTKAASINAD 590 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 3.2 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -1 Query: 260 LICLGFDMIVIIFSTSSSVHSPARLSRSMSAFLRTMLEYLRPTPLIAVIAN 108 ++C+ MI I F+TS ++ R + + T+ L PT ++ A+ Sbjct: 593 MLCIPGYMIYIWFTTSGTISEKFRKLIRIEDNVATLRMKLNPTKAASINAD 643 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.8 bits (44), Expect = 4.2 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -1 Query: 263 YLICLGFDMIVIIFSTSSSVHSPARL 186 ++ +G M+V IF ++ S+ +P+ L Sbjct: 30 FVSVMGNGMVVYIFLSTKSLRTPSNL 55 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 181 DQCRLF*EQCWS 146 D+C EQCWS Sbjct: 829 DECWRLMEQCWS 840 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 181 DQCRLF*EQCWS 146 D+C EQCWS Sbjct: 867 DECWRLMEQCWS 878 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 20.6 bits (41), Expect = 9.8 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +3 Query: 54 STYSSYHEYEHRW 92 +TY+ EY+H W Sbjct: 153 TTYTPVCEYDHTW 165 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,468 Number of Sequences: 438 Number of extensions: 3084 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -