BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20514 (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 55 5e-10 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 55 5e-10 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 52 3e-09 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 52 4e-09 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.3 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 22 5.2 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 9.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 9.1 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 9.1 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 55.2 bits (127), Expect = 5e-10 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = +1 Query: 355 LYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP 507 + P D E++LS+ +++K+ Y WLG GLL STG KW++ RK++ P Sbjct: 89 ILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTP 139 Score = 36.7 bits (81), Expect = 2e-04 Identities = 16/53 (30%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = +3 Query: 510 FHLNVLKSFIELFNANSRAVVDKLKKEASN--FDCHDYMSECTVEILLETAMG 662 FH ++L+ F+ +FN + +V+ LK+E + + ++++ T++ + ETAMG Sbjct: 141 FHFSILQQFVAIFNEETDKLVEVLKEECYKPFVNVNAHVAQFTLKTIAETAMG 193 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 55.2 bits (127), Expect = 5e-10 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = +1 Query: 355 LYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP 507 + P D E++LS+ +++K+ Y WLG GLL STG KW++ RK++ P Sbjct: 89 ILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTP 139 Score = 37.1 bits (82), Expect = 1e-04 Identities = 16/53 (30%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = +3 Query: 510 FHLNVLKSFIELFNANSRAVVDKLKKEASN--FDCHDYMSECTVEILLETAMG 662 FH ++L+ F+ +FN + +V+ LK+E + + ++++ T++ + ETAMG Sbjct: 141 FHFSILQQFVAIFNEETDKLVEVLKEECYKPFINVNAHVAQFTLKTIAETAMG 193 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 52.4 bits (120), Expect = 3e-09 Identities = 23/53 (43%), Positives = 32/53 (60%) Frame = +1 Query: 349 VFLYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP 507 V L +P DVE++L+ K+ Y F WLG GLL S G KW++ RK++ P Sbjct: 80 VNLLNPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSAGPKWQNRRKILTP 132 Score = 36.7 bits (81), Expect = 2e-04 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Frame = +3 Query: 510 FHLNVLKSFIELFNANSRAVVDKLKKEASN--FDCHDYMSECTVEILLETAMGV 665 FH N+L+ FI++FN ++ +V+ L+ E D +++ T+ + ETAMG+ Sbjct: 134 FHFNILQEFIQIFNEETKRLVEDLEAECHKPYIDVVVPITQFTLLSIGETAMGI 187 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 52.0 bits (119), Expect = 4e-09 Identities = 23/53 (43%), Positives = 32/53 (60%) Frame = +1 Query: 349 VFLYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP 507 V L +P DVE++L+ K+ Y F WLG GLL S G KW++ RK++ P Sbjct: 80 VNLLNPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSRGPKWQNRRKILTP 132 Score = 37.1 bits (82), Expect = 1e-04 Identities = 18/54 (33%), Positives = 34/54 (62%), Gaps = 2/54 (3%) Frame = +3 Query: 510 FHLNVLKSFIELFNANSRAVVDKLKKEASN--FDCHDYMSECTVEILLETAMGV 665 FH N+L+ FI++FN ++ +V+ L+ E+ D +++ T+ + ETAMG+ Sbjct: 134 FHFNILQEFIQIFNEETKRLVEDLEAESHKPYIDVVVPITQFTLLSIGETAMGI 187 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 284 FRRALTTITNPSLRSG*DPVSSSFCT-ILATW 376 FRR L NPSLR G + C +L W Sbjct: 23 FRRGLRLHDNPSLREGLKGARTFRCVFVLDPW 54 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 433 KPWLGNGLLISTGQKWRSHRKLIAP 507 +P L L G+KW+ R ++P Sbjct: 69 EPLLSEALTNLPGEKWKEMRATLSP 93 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 258 STTNSRAFPSNGSPGGPFNLSASSY 184 +TT + + N +P FN+S S+Y Sbjct: 12 TTTTTTSSALNSTPLIEFNISTSNY 36 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 258 STTNSRAFPSNGSPGGPFNLSASSY 184 +TT + + N +P FN+S S+Y Sbjct: 12 TTTTTTSSALNSTPLIEFNISTSNY 36 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 531 SFIELFNANSRAVVDKLKKE 590 +F+E N + + V D LKKE Sbjct: 168 AFLERENCHLKFVTDTLKKE 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,372 Number of Sequences: 336 Number of extensions: 2886 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -