BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20512 (434 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73020.1 68414.m08444 expressed protein contains Pfam profile... 46 8e-06 At1g15520.1 68414.m01867 ABC transporter family protein similar ... 29 1.4 At1g59870.1 68414.m06745 ABC transporter family protein similar ... 27 4.1 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 26 9.5 At2g36380.1 68415.m04464 ABC transporter family protein related ... 26 9.5 >At1g73020.1 68414.m08444 expressed protein contains Pfam profile PF04547: Protein of unknown function, DUF590; expression supported by MPSS Length = 558 Score = 46.4 bits (105), Expect = 8e-06 Identities = 21/58 (36%), Positives = 33/58 (56%) Frame = +3 Query: 3 LAPLFALINNVLEMRLDARKFLTCFRRPVPQRVTDIGVWYRILDSIGKLSVITNGFII 176 LA A ++NV+E+R +A K L RRP+P+ IG W I + +S+ TN ++ Sbjct: 413 LAFALAAVSNVMEIRTNALKLLVTLRRPLPRAAATIGAWLNIWQFLVVMSICTNSALL 470 >At1g15520.1 68414.m01867 ABC transporter family protein similar to ABC1 protein GI:14331118 from [Nicotiana plumbaginifolia] Length = 1423 Score = 29.1 bits (62), Expect = 1.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 368 HSTWYWHIIGATLAFVVVF 424 H+ WYW GA L FVV+F Sbjct: 747 HAYWYWIGTGALLGFVVLF 765 >At1g59870.1 68414.m06745 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1469 Score = 27.5 bits (58), Expect = 4.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 Query: 362 YAHSTWYWHIIGATLAFVVVF 424 Y WYW +GA L F +F Sbjct: 764 YHQKNWYWISVGALLCFTALF 784 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 26.2 bits (55), Expect = 9.5 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +2 Query: 227 LAGAVRQQHVADFNITVLE 283 LAG++R++HVAD +I LE Sbjct: 620 LAGSLRREHVADASIKKLE 638 >At2g36380.1 68415.m04464 ABC transporter family protein related to multi drug resistance proteins and P-glycoproteins Length = 1453 Score = 26.2 bits (55), Expect = 9.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 377 WYWHIIGATLAFVVVF 424 W+W IGA L F V+F Sbjct: 772 WFWICIGALLGFTVLF 787 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,126,925 Number of Sequences: 28952 Number of extensions: 116244 Number of successful extensions: 433 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 683042040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -