BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20510 (681 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0611 - 22721977-22722276,22722765-22722853,22722978-227230... 35 0.069 10_08_0513 + 18460095-18460170,18460362-18460441,18461029-184614... 31 0.84 05_04_0236 + 19301730-19302222,19302308-19302440,19302640-19303036 31 0.84 02_01_0538 + 3932581-3932632,3933014-3933219 29 4.5 01_07_0042 + 40697153-40697407,40697479-40698081 29 4.5 12_01_0550 - 4411926-4412207,4414661-4414774 28 7.9 06_02_0136 + 12195422-12195435,12196047-12196122,12196896-121977... 28 7.9 04_04_0789 - 28068819-28068989,28069081-28069477,28069857-280700... 28 7.9 02_05_0422 - 28831195-28831254,28831345-28831833,28831924-288320... 28 7.9 >06_03_0611 - 22721977-22722276,22722765-22722853,22722978-22723083, 22723178-22723306,22723803-22723887,22723994-22724103, 22724424-22724624,22725033-22725394,22725612-22725695, 22725791-22725916,22725999-22726161,22726378-22726536, 22727147-22727274,22727371-22727493,22727755-22727899, 22727992-22728068,22728318-22728696,22729325-22729411 Length = 950 Score = 34.7 bits (76), Expect = 0.069 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 3/93 (3%) Frame = +1 Query: 211 KQNLFVFGENELKNAMRLLTVMVVASLVPAIQARARRYSRMQPNALSKTRCDLMCFDRDK 390 ++NL +F + K +RL+ V + L+ I R +P K RC C D + Sbjct: 23 RKNL-IFQKRNRKGTIRLIIVPIYLCLLLTILQRVINSVLDKP----KFRCGCKCVDVNG 77 Query: 391 ETKGTCRSQCRNQEH---KPGKCPVSDTPKWEA 480 G+C++ C Q + G CP+ + P+W A Sbjct: 78 T--GSCQNVCGIQYSTLDQAGSCPIPNPPEWPA 108 >10_08_0513 + 18460095-18460170,18460362-18460441,18461029-18461491, 18461914-18462073,18462177-18462451,18462634-18462801, 18463012-18463064 Length = 424 Score = 31.1 bits (67), Expect = 0.84 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +1 Query: 322 YSRMQPNALSKTRCDLMCFDRDKETK-GTCRSQCRNQEHKPGKCPVSDTP 468 YS+ + L FD DK TC CRN++ GKC + P Sbjct: 215 YSQFLAQKVPSCCVSLSSFDNDKTVDCPTCSCGCRNEKSTTGKCVKKNAP 264 >05_04_0236 + 19301730-19302222,19302308-19302440,19302640-19303036 Length = 340 Score = 31.1 bits (67), Expect = 0.84 Identities = 24/65 (36%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Frame = +1 Query: 244 LKNAMRLLTVMVVASLVPAIQARARRYSRMQ-----PNALSKTRCDLMCFDRDKETKGTC 408 L+ AM+ L + V+A A ARA + R PN L +R C D KG C Sbjct: 9 LQVAMKALALAVLALAYAAATARAEQCGRQAGGARCPNRLCCSRWG-WCGLTDDYCKGGC 67 Query: 409 RSQCR 423 +SQCR Sbjct: 68 QSQCR 72 >02_01_0538 + 3932581-3932632,3933014-3933219 Length = 85 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = +1 Query: 370 MCFDRDKETKG------TCRSQCRNQEHKPGKCPVSDTPKWEAACVQACNSDS 510 MC DR + KG C + C N+ + G C T + C + C DS Sbjct: 26 MCHDRSQTFKGMCFRTSNCNTSCTNEGYTGGHC---TTFRRRCVCTKECGGDS 75 >01_07_0042 + 40697153-40697407,40697479-40698081 Length = 285 Score = 28.7 bits (61), Expect = 4.5 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 2/78 (2%) Frame = -3 Query: 631 FSFGSSIVGTAGRPGKVNKSKGSLQVEPHPW*--QHLCVPSHWSRSCRPARMRLPISACP 458 F+ S V A ++ S +Q+ P P Q V HW SC P R R CP Sbjct: 33 FNISDSKVVAADASAAISGSMDWIQL-PSPMFNFQASSVAHHWEISCFPLRGR---EGCP 88 Query: 457 KRGIFPACALDSDIGNDT 404 P+ +D D G+ T Sbjct: 89 ISLFVPSTNVDDDDGDGT 106 >12_01_0550 - 4411926-4412207,4414661-4414774 Length = 131 Score = 27.9 bits (59), Expect = 7.9 Identities = 24/92 (26%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = +1 Query: 139 SVLMQEVVTFMDHLLFYREREMC*KQNLFVFGENELKNAMRLLTV-MVVASLVPAIQARA 315 S+ M+ +D L F RE L+V + A+R+ T + L Sbjct: 21 SIEMEPKTLTLDQLKFAREAA------LYVLSTKPAEEAIRIFTEGLKPVHLAAGCGGGG 74 Query: 316 RRYSRMQPNALSKTRCDLMCFDRDKETKGTCR 411 R+ S M ++ S D+ CF D K CR Sbjct: 75 RKSSTMAADSSSDDDLDIGCFHDDYAGKSYCR 106 >06_02_0136 + 12195422-12195435,12196047-12196122,12196896-12197707, 12197941-12198010,12199469-12199557,12199633-12199666 Length = 364 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -2 Query: 524 CAVALESELQACTHAASHFGV-SETGHFPGLCS*FRHWERHVPLVSLSLSKHIRS 363 C+V L+ L T A FG+ SE H P S R+W + P + ++ +R+ Sbjct: 212 CSVCLDRVLSKPTAAERKFGLLSECDH-PFCISCIRNWRNNSPTSGMDVNSALRA 265 >04_04_0789 - 28068819-28068989,28069081-28069477,28069857-28070009, 28070698-28070834 Length = 285 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +2 Query: 392 KLKERVVPNVGIKSTSRENAPFRTRRNG-KPHACRPATPTPMRRH 523 +L++R + + GI+++ R T +NG KPH C P +P RRH Sbjct: 81 ELEQRPLMDYGIEASER------TSKNGPKPH-CTPPSPPKHRRH 118 >02_05_0422 - 28831195-28831254,28831345-28831833,28831924-28832052, 28832179-28832538 Length = 345 Score = 27.9 bits (59), Expect = 7.9 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 5/88 (5%) Frame = -2 Query: 563 TASRTASVVTAPLCAVALESELQACTHAASHFGV--SETGHFPGL---CS*FRHWERHVP 399 T S A+ A A + A A+S++G+ S+ G+ S FR WE + P Sbjct: 68 TGSTAAAKAEATKAAKEGPASATASPVASSYWGIEASKLASKDGVEWKWSCFRPWETYSP 127 Query: 398 LVSLSLSKHIRSHLVFDKALGCILEYLR 315 ++ L KH ++ DK ++ LR Sbjct: 128 DTTIDLKKHHEPKVLLDKVAYWTVKALR 155 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,774,028 Number of Sequences: 37544 Number of extensions: 407073 Number of successful extensions: 1335 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1335 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -