BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20510 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 3.6 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 4.7 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 6.2 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 511 WSRSCRPARMRLPISACPKR 452 WSR R A +R+ + CP R Sbjct: 393 WSRDFRRAFVRILCACCPGR 412 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 494 PATPTPMRRHTEVLSPRMRFY 556 P T T + +H++ SP++R Y Sbjct: 211 PVTLTTVPKHSKTKSPKLRPY 231 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 6.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 371 CALTGIRKLKERVVPNVGIKSTSRENAPFRTRRNGKP 481 CA+ G LKER N K S + + +R+G+P Sbjct: 30 CAVYGDEALKERQCQNWFDKFRSGDFSLKDEKRSGRP 66 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,183 Number of Sequences: 438 Number of extensions: 4135 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -