BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20508 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 22 5.5 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.7 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 126 HPPRPLYINKLCPIKEQTLV 67 H +P + LC IKE+T++ Sbjct: 68 HRMKPALFSVLCEIKEKTVL 87 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/39 (20%), Positives = 19/39 (48%) Frame = +3 Query: 573 KLREEVTFAHSSANEVLEKTGYKNNVVLYRPKRLQNKFE 689 +L + FAH ++NE + + +++ L+ K + Sbjct: 580 ELARKAAFAHLNSNEARATLNWVSKLIIRSNPSLEEKLQ 618 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,917 Number of Sequences: 336 Number of extensions: 3402 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -