BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20508 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 76 3e-14 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 76 3e-14 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 74 8e-14 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 62 3e-10 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 60 1e-09 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 60 1e-09 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 58 6e-09 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 58 6e-09 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 54 7e-08 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 48 6e-06 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 48 6e-06 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 46 3e-05 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 45 6e-05 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 42 3e-04 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 41 0.001 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 41 0.001 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 41 0.001 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 39 0.003 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.015 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 36 0.026 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 35 0.045 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 35 0.060 At3g19780.1 68416.m02504 expressed protein 33 0.14 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 33 0.14 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 33 0.14 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 32 0.42 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 32 0.42 At1g08430.1 68414.m00932 expressed protein contains Pfam profile... 31 0.73 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 31 0.97 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 30 1.3 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 29 2.2 At5g37950.1 68418.m04571 hypothetical protein 29 2.2 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 29 2.2 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 29 2.2 At1g08440.1 68414.m00933 hypothetical protein contains Pfam prof... 29 2.2 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 29 3.0 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 29 3.0 At3g52510.1 68416.m05774 F-box family protein-related contains w... 29 3.9 At1g61970.1 68414.m06990 mitochondrial transcription termination... 29 3.9 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 28 5.2 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 28 5.2 At3g03860.1 68416.m00398 expressed protein 28 5.2 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 28 5.2 At1g62085.1 68414.m07006 mitochondrial transcription termination... 28 5.2 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 28 5.2 At2g16040.1 68415.m01839 hAT dimerisation domain-containing prot... 28 6.8 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 27 9.0 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 27 9.0 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 27 9.0 At1g08060.2 68414.m00881 MOM1 identical to MOM1 (mutation in a '... 27 9.0 At1g08060.1 68414.m00880 MOM1 identical to MOM1 (mutation in a '... 27 9.0 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/77 (46%), Positives = 51/77 (66%), Gaps = 2/77 (2%) Frame = +2 Query: 257 LKTDDPPVALAKVDCTEG-GKSTCEQFSVSGYPTLKIFRKG-ELSSEYNGPRESNGIVKY 430 L ++ PPV LAK+D +E + Q+ V G+PT+KIFR G + EYNGPRE+ GIV Y Sbjct: 76 LSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTY 135 Query: 431 MRAQVGPSSKELLTVAD 481 ++ Q GP+S E+ + D Sbjct: 136 LKKQSGPASAEIKSADD 152 Score = 59.3 bits (137), Expect = 2e-09 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +3 Query: 117 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 +E VL L ++F+ +++HD +V FYAPWCGHCK+L PEY AA Sbjct: 29 KEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQLAPEYEKAA 73 Score = 41.5 bits (93), Expect = 5e-04 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 135 LTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKP 233 ++DS VL+ L+ FYAPWCGHC++L P Sbjct: 380 VSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/77 (46%), Positives = 51/77 (66%), Gaps = 2/77 (2%) Frame = +2 Query: 257 LKTDDPPVALAKVDCTEG-GKSTCEQFSVSGYPTLKIFRKG-ELSSEYNGPRESNGIVKY 430 L ++ PPV LAK+D +E + Q+ V G+PT+KIFR G + EYNGPRE+ GIV Y Sbjct: 76 LSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTY 135 Query: 431 MRAQVGPSSKELLTVAD 481 ++ Q GP+S E+ + D Sbjct: 136 LKKQSGPASAEIKSADD 152 Score = 59.3 bits (137), Expect = 2e-09 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +3 Query: 117 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 +E VL L ++F+ +++HD +V FYAPWCGHCK+L PEY AA Sbjct: 29 KEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQLAPEYEKAA 73 Score = 41.5 bits (93), Expect = 5e-04 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 135 LTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKP 233 ++DS VL+ L+ FYAPWCGHC++L P Sbjct: 380 VSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 74.1 bits (174), Expect = 8e-14 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 2/72 (2%) Frame = +2 Query: 257 LKTDDPPVALAKVDCTE-GGKSTCEQFSVSGYPTLKIFRKGELS-SEYNGPRESNGIVKY 430 L + +PP+ALAK+D +E K ++ + G+PTLKI R G S +YNGPRE+ GIV Y Sbjct: 75 LSSHNPPLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTY 134 Query: 431 MRAQVGPSSKEL 466 ++ Q GP+S E+ Sbjct: 135 LKKQSGPASVEI 146 Score = 64.1 bits (149), Expect = 9e-11 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +3 Query: 51 FEMFGSLKFVLLLGIIYLCKAAEED---VLDLTDSDFSAVLSQHDTALVMFYAPWCGHCK 221 F+ F +LLL + +EE VL L S+F+ +S+HD +V FYAPWCGHC+ Sbjct: 3 FKGFACFSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQ 62 Query: 222 RLKPEYAVAA 251 +L PEY AA Sbjct: 63 KLAPEYEKAA 72 Score = 38.7 bits (86), Expect = 0.004 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 159 VLSQHDTALVMFYAPWCGHCKRLKP 233 V L+ FYAPWCGHC++L P Sbjct: 386 VFKSGKNVLIEFYAPWCGHCQKLAP 410 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 62.1 bits (144), Expect = 3e-10 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +3 Query: 126 VLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 VL+LTDS+F + +S D V FYAPWCGHCKRL PE AA Sbjct: 34 VLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAA 75 Score = 37.5 bits (83), Expect = 0.008 Identities = 16/59 (27%), Positives = 35/59 (59%) Frame = +2 Query: 275 PVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGP 451 P+ +AK++ + + + + +PTL ++ G + EY GPR+++ +V+Y++ V P Sbjct: 84 PIVIAKLNADKYSR-LARKIEIDAFPTLMLYNHG-VPMEYYGPRKADLLVRYLKKFVAP 140 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/55 (49%), Positives = 33/55 (60%) Frame = +3 Query: 75 FVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEY 239 F L + L A +DV+ LTD F + + ALV FYAPWCGHCK+L PEY Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEY 62 Score = 56.8 bits (131), Expect = 1e-08 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = +2 Query: 278 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELS-SEYNGPRESNGIVKYMRAQVGPS 454 V +AKVDC E KS C ++ VSGYPT++ F KG L +Y GPR + + +Y+ + G + Sbjct: 75 VLIAKVDCDEQ-KSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTN 133 Query: 455 SK 460 K Sbjct: 134 VK 135 Score = 51.2 bits (117), Expect = 6e-07 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 111 AAEEDVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 A ++V+ LT +F VL Q+ LV FYAPWCGHCK L P Y A Sbjct: 138 AVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVA 185 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 3/68 (4%) Frame = +2 Query: 278 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRK-GELSSEYNGPRESNGIVKYMRAQVGPS 454 V +A +D + K+ E++ VSG+PTLK F K + +Y+G R+ + V ++ + G S Sbjct: 194 VVIANLDA-DAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS 252 Query: 455 --SKELLT 472 SK LT Sbjct: 253 RDSKGQLT 260 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/55 (49%), Positives = 33/55 (60%) Frame = +3 Query: 75 FVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEY 239 F L + L A +DV+ LTD F + + ALV FYAPWCGHCK+L PEY Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEY 62 Score = 56.8 bits (131), Expect = 1e-08 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = +2 Query: 278 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELS-SEYNGPRESNGIVKYMRAQVGPS 454 V +AKVDC E KS C ++ VSGYPT++ F KG L +Y GPR + + +Y+ + G + Sbjct: 75 VLIAKVDCDEQ-KSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTN 133 Query: 455 SK 460 K Sbjct: 134 VK 135 Score = 51.2 bits (117), Expect = 6e-07 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 111 AAEEDVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 A ++V+ LT +F VL Q+ LV FYAPWCGHCK L P Y A Sbjct: 138 AVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVA 185 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 3/68 (4%) Frame = +2 Query: 278 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRK-GELSSEYNGPRESNGIVKYMRAQVGPS 454 V +A +D + K+ E++ VSG+PTLK F K + +Y+G R+ + V ++ + G S Sbjct: 194 VVIANLDA-DAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS 252 Query: 455 --SKELLT 472 SK LT Sbjct: 253 RDSKGQLT 260 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 58.0 bits (134), Expect = 6e-09 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 117 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 E+DV+ + + +F+ V+ + LV FYAPWCGHC+ L PEYA AA Sbjct: 102 EKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Score = 48.0 bits (109), Expect = 6e-06 Identities = 26/70 (37%), Positives = 38/70 (54%) Frame = +2 Query: 278 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGPSS 457 V LAK+D TE + +++ V G+PTL F GE Y G R IV +++ ++GP Sbjct: 154 VVLAKIDATEENE-LAQEYRVQGFPTLLFFVDGE-HKPYTGGRTKETIVTWVKKKIGPGV 211 Query: 458 KELLTVADFE 487 L T+ D E Sbjct: 212 YNLTTLDDAE 221 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 117 EEDVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEY 239 +EDV + +F VL L+ YAPWCGHC+ L+P Y Sbjct: 440 DEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMY 481 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 58.0 bits (134), Expect = 6e-09 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 117 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 E+DV+ + + +F+ V+ + LV FYAPWCGHC+ L PEYA AA Sbjct: 102 EKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Score = 48.0 bits (109), Expect = 6e-06 Identities = 26/70 (37%), Positives = 38/70 (54%) Frame = +2 Query: 278 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGPSS 457 V LAK+D TE + +++ V G+PTL F GE Y G R IV +++ ++GP Sbjct: 154 VVLAKIDATEENE-LAQEYRVQGFPTLLFFVDGE-HKPYTGGRTKETIVTWVKKKIGPGV 211 Query: 458 KELLTVADFE 487 L T+ D E Sbjct: 212 YNLTTLDDAE 221 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 117 EEDVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEY 239 +EDV + +F VL L+ YAPWCGHC+ L+P Y Sbjct: 440 DEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMY 481 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 54.4 bits (125), Expect = 7e-08 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +3 Query: 117 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 E+DV LT +F+ + + A+V FYAPWCG C+ L PEYA AA Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAA 142 Score = 54.4 bits (125), Expect = 7e-08 Identities = 25/75 (33%), Positives = 42/75 (56%) Frame = +2 Query: 281 ALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGPSSK 460 ALAK+D TE G +++ + G+PT+ +F GE+ Y G R +GIV +++ + PS Sbjct: 150 ALAKIDATEEG-DLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIH 208 Query: 461 ELLTVADFEAFTSKD 505 + T + E S + Sbjct: 209 NITTKEEAERVLSAE 223 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 123 DVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEY 239 DV + ++F VL + L+ YAPWCGHC+ +P Y Sbjct: 438 DVKVIVGNNFDEIVLDESKDVLLEIYAPWCGHCQSFEPIY 477 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 48.0 bits (109), Expect = 6e-06 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = +3 Query: 126 VLDLTDSDF-SAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 V+ LT S+F S VL+ + LV F+APWCGHCK L P + A Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVA 74 Score = 46.0 bits (104), Expect = 2e-05 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +3 Query: 129 LDLTDSDFS-AVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 ++L S+F V+ ++ +V F+APWCGHCK+L PE+ AA Sbjct: 165 VELNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAA 206 Score = 37.9 bits (84), Expect = 0.006 Identities = 14/54 (25%), Positives = 30/54 (55%) Frame = +2 Query: 284 LAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQV 445 +A +D + +S + + + G+PT+K+F G+ +Y G R++ I + Q+ Sbjct: 83 VAAIDA-DAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQI 135 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 48.0 bits (109), Expect = 6e-06 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = +3 Query: 126 VLDLTDSDF-SAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 VL LT S+F S VL+ + LV F+APWCGHC+ L P + A Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVA 72 Score = 46.0 bits (104), Expect = 2e-05 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +3 Query: 129 LDLTDSDFSAVLSQH-DTALVMFYAPWCGHCKRLKPEYAVAA 251 ++L S+F ++++ + +V F+APWCGHCK+L PE+ AA Sbjct: 166 VELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAA 207 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/62 (29%), Positives = 34/62 (54%) Frame = +2 Query: 284 LAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGPSSKE 463 +A +D + KS + + V G+PT+K+F G+ +Y G R++ I ++ Q+ K+ Sbjct: 81 VAAIDA-DAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIKALLKD 139 Query: 464 LL 469 L Sbjct: 140 RL 141 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 45.6 bits (103), Expect = 3e-05 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 9/84 (10%) Frame = +2 Query: 227 KARVRCSRRLLKTDDPPVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKG-ELSSE---- 391 KA + R D V LAKVDCT+ G C + + GYP+++IFRKG +L + Sbjct: 182 KAAKQIKERYDPEMDGRVILAKVDCTQEG-DLCRRNHIQGYPSIRIFRKGSDLKDDNAHH 240 Query: 392 ----YNGPRESNGIVKYMRAQVGP 451 Y G R++ +VK + + V P Sbjct: 241 DHESYYGDRDTESLVKMVVSLVEP 264 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +3 Query: 120 EDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 ED + LT +F Q +V FYAPWC C LKP + AA Sbjct: 141 EDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAA 184 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 44.8 bits (101), Expect = 6e-05 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 9/79 (11%) Frame = +2 Query: 269 DPPVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSE---------YNGPRESNGI 421 D V L VDCTE + C++ + GYP+++IFRKG E Y G R+++ I Sbjct: 196 DGRVLLGNVDCTEE-PALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSI 254 Query: 422 VKYMRAQVGPSSKELLTVA 478 VK + V P E VA Sbjct: 255 VKMVEGLVAPIHPETHKVA 273 Score = 35.1 bits (77), Expect = 0.045 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 120 EDVLDLTDSDFSAVLSQHDTALVM-FYAPWCGHCKRLKPEYAVAA 251 + + LT + F A LS H LV+ F APWC RLKP + AA Sbjct: 141 DGAIPLTSASFEA-LSHHFPILVVNFNAPWCYWSNRLKPSWEKAA 184 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 42.3 bits (95), Expect = 3e-04 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 9/76 (11%) Frame = +2 Query: 263 TDDPPVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSE---------YNGPRESN 415 TDD V L VDCTE + C+ + GYP+++IFR+G E Y G R+++ Sbjct: 196 TDDR-VLLGSVDCTEE-PTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTD 253 Query: 416 GIVKYMRAQVGPSSKE 463 +VK + + P KE Sbjct: 254 SLVKMVEELLKPIKKE 269 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 129 LDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 + LT + F +V FYAPWC RLKP + A+ Sbjct: 145 IPLTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKAS 185 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +3 Query: 78 VLLLGI-IYLCKAAEEDVLDLTDSDFSAVLSQHDTA-LVMFYAPWCGHCKRL 227 +LLL I I L KA +V+ LT FS + + DTA V F PWC HCK+L Sbjct: 13 ILLLFIPIELVKA---EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +2 Query: 269 DPPVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYM 433 D + + +VDC ++ C + + YPT +F GE S+Y G R+ + ++ Sbjct: 75 DDEIEVGEVDCGTS-RAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFV 128 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +3 Query: 78 VLLLGI-IYLCKAAEEDVLDLTDSDFSAVLSQHDTA-LVMFYAPWCGHCKRL 227 +LLL I I L KA +V+ LT FS + + DTA V F PWC HCK+L Sbjct: 13 ILLLFIPIELVKA---EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +2 Query: 269 DPPVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYM 433 D + + +VDC ++ C + + YPT +F GE S+Y G R+ + ++ Sbjct: 75 DDEIEVGEVDCGTS-RAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFV 128 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +3 Query: 78 VLLLGI-IYLCKAAEEDVLDLTDSDFSAVLSQHDTA-LVMFYAPWCGHCKRL 227 +LLL I I L KA +V+ LT FS + + DTA V F PWC HCK+L Sbjct: 13 ILLLFIPIELVKA---EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +2 Query: 269 DPPVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYM 433 D + + +VDC ++ C + + YPT +F GE S+Y G R+ + ++ Sbjct: 75 DDEIEVGEVDCGTS-RAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFV 128 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 111 AAEEDVLDLTDSDFSAVLSQHDT-ALVMFYAPWCGHCKRLKP 233 AA +V +L+DS++ + + D LV F+APWCG C+ + P Sbjct: 83 AAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +3 Query: 102 LCKAAEE--DVLDLTDSDF-SAVLSQHDTALVMFYAPWCGHCKRLKP 233 +C+A E D+ + DS + S VL +V F+APWCG CK + P Sbjct: 72 VCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 114 AEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 A+ VL+L V+ ++ +V+ YAPWC L P +A AA Sbjct: 75 AQRIVLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAA 120 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 35.1 bits (77), Expect = 0.045 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 114 AEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 251 A+ V++L + ++ ++ +V+ YAPWC L P +A AA Sbjct: 73 AQRIVVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAA 118 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 34.7 bits (76), Expect = 0.060 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 90 GIIYLCKAAEEDVLDLTDSDF-SAVLSQHDTALVMFYAPWCGHCKRLKP 233 G+I + + + DS + S VL + V F+APWCG CK + P Sbjct: 64 GVICEAQDTATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDP 112 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = +3 Query: 69 LKFVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPE 236 L F++ + II L + + LT+ +FS+ + H L+ PWCG + LK E Sbjct: 9 LPFLVFVSII-LPSSCHGEWEILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYE 63 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 117 EEDVLDLTDSDFSAVLSQHDT--ALVMFYAPWCGHCKRLKPEYAVAA 251 ++ ++L ++F +VL A+V F+A WC C+ KP Y A Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 126 VLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKP 233 + ++ +S+FS+ VL LV F A WCG CK + P Sbjct: 71 IKEIGESEFSSTVLESAQPVLVEFVATWCGPCKLIYP 107 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 117 EEDVLDLTDSDFSAVLSQHDT--ALVMFYAPWCGHCKRLKPEYAVAA 251 +++ ++L ++F +V A++ F+A WC C+ KP Y A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 117 EEDVLDLTDSDFSAVLSQHDT--ALVMFYAPWCGHCKRLKPEYAVAA 251 +++ ++L ++F +V A++ F+A WC C+ KP Y A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g08430.1 68414.m00932 expressed protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 493 Score = 31.1 bits (67), Expect = 0.73 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = +3 Query: 21 VRFC*KAPAKFEMFGSLKFVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALV--MF 194 VRF KF+ +G L F+L +I L +E+++DL +S S V+ + ++ +F Sbjct: 124 VRFFPWVKTKFD-YGILIFILTFALISLSGFRDEEIMDLAESRLSTVVIGGVSCILISIF 182 Query: 195 YAP-WCG 212 P W G Sbjct: 183 VCPVWAG 189 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 30.7 bits (66), Expect = 0.97 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 132 DLTDS--DFSAVLSQHDTALVMFYAPWCGHCKRLKPE 236 DLT S + LS +V FYA WC C+ L P+ Sbjct: 123 DLTASALPYEEALSNGKPTVVEFYADWCEVCRELAPD 159 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 138 TDSDFSAVLSQHDT-ALVMFYAPWCGHCKRLKP 233 T + F +L D LV FYA WCG C+ + P Sbjct: 64 TFNSFDDLLQNSDKPVLVDFYATWCGPCQLMVP 96 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +3 Query: 108 KAAEEDVLDLTDSDF--SAVLSQHDTALVM-FYAPWCGHCKRLKPE 236 K+ ++L++ ++ ++L+ D +V+ FY+P CG CK L P+ Sbjct: 81 KSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPK 126 >At5g37950.1 68418.m04571 hypothetical protein Length = 351 Score = 29.5 bits (63), Expect = 2.2 Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 4/102 (3%) Frame = -3 Query: 507 SSLEVKASKSATVR--SSLELGPT-WARMYLTMPLDSLGPLYSEESSPFLKIFSVGYPDT 337 SS E + S + S LE+ W + L +P+ +GPLY S+P + + Sbjct: 174 SSCEKGTASSMIINTVSCLEISSLEWLQQELKIPIYPIGPLYMVSSAPPTSLLD----EN 229 Query: 336 ENCSQVLLPPSVQSTLASATGGSSVFNSRR-LQRTLALVSYN 214 E+C L S + + G ++ ++ L+ LVS N Sbjct: 230 ESCIDWLNKQKPSSVIYISLGSFTLLETKEVLEMASGLVSSN 271 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/51 (25%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +3 Query: 108 KAAEEDVLDLTDSD--FSAVLSQHDTALVM-FYAPWCGHCKRLKPEYAVAA 251 + A +++D+T ++ +A+ D +++ FY WCG C+ + P+ A Sbjct: 89 RKAGPNMIDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTA 139 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/64 (28%), Positives = 25/64 (39%) Frame = +3 Query: 42 PAKFEMFGSLKFVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCK 221 P + G LKF L E DS +++ LV +YA WCG C+ Sbjct: 38 PVRRVRTGDLKFPSLSSTTRCTPRRIEAKKQTFDSFEDLLVNSDKPVLVDYYATWCGPCQ 97 Query: 222 RLKP 233 + P Sbjct: 98 FMVP 101 >At1g08440.1 68414.m00933 hypothetical protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 501 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = +3 Query: 21 VRFC*KAPAKFEMFGSLKFVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALV--MF 194 VRF + A+++ +G L F+L +I + E+++LDL S V+ + ++ +F Sbjct: 121 VRFFPRVKARYD-YGVLIFILTFALISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIF 179 Query: 195 YAP-WCG 212 P W G Sbjct: 180 VCPVWAG 186 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 144 SDFSAVLSQHDTALVMFYAPWCGHCKRLKPE 236 S +A+ + ++ F A WCG CK L+P+ Sbjct: 50 SRLNALKDTNKLLVIEFTAKWCGPCKTLEPK 80 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 183 LVMFYAPWCGHCKRLKPEY 239 LV+ YAPWC C+ ++ Y Sbjct: 366 LVVLYAPWCPFCQAMEASY 384 >At3g52510.1 68416.m05774 F-box family protein-related contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain Length = 177 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -3 Query: 510 YSSLEVKASKSATVRSSLELGPTWARMYLTMPLDSLGPLYSEE 382 YS L V AS V ++ W++ L +PLD + ++ ++ Sbjct: 97 YSKLAVDASVDLRVMEDVKKKKKWSKKTLVLPLDQMNVVHGDD 139 >At1g61970.1 68414.m06990 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 418 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 531 KGI*PEREFLKTADKLREEVTFAHSSANEVLEKTGYKNNVVLY 659 K + P+ +FL++ E+T SS E+L K G+K V Y Sbjct: 118 KSLGPKLQFLQSRGASSSEITEIVSSVPEILGKKGHKTISVYY 160 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 141 DSDFSAVLSQHDTALVM-FYAPWCGHCKRLKPEY 239 D+ + V + D +V+ Y WCG CK + P+Y Sbjct: 86 DTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKY 119 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = +2 Query: 290 KVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVG 448 K+DC + K ++ + PT KI + ++ E G + + + A+ G Sbjct: 133 KLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAARSG 185 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 28.3 bits (60), Expect = 5.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 183 LVMFYAPWCGHCKRLKPEY 239 +V+ YAPWC C+ ++ Y Sbjct: 377 IVVLYAPWCPFCQAMEASY 395 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 141 DSDFSAVLSQHDTAL--VMFYAPWCGHCKRLKPEY 239 DS + SQH A V+FYA WC + ++P++ Sbjct: 62 DSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKF 96 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 156 AVLSQHDTALVMFYAPWCGHCK 221 +VL LV FY WCG C+ Sbjct: 79 SVLKSETPVLVEFYTSWCGPCR 100 >At1g62085.1 68414.m07006 mitochondrial transcription termination factor family protein / mTERF family protein contains Pfam profile PF02536: mTERF Length = 461 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 531 KGI*PEREFLKTADKLREEVTFAHSSANEVLEKTGYKNNVVLY 659 K I P+ +FL++ R E+T S+ E+L K G K + Y Sbjct: 121 KSIGPKLQFLQSRGASRSELTHIVSTVPEILGKRGDKTISIYY 163 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 165 SQHDTALVMFYAPWCGHCKRLKP 233 SQ +VMF A WCG C+ + P Sbjct: 225 SQTPHVMVMFTARWCGPCRDMIP 247 >At2g16040.1 68415.m01839 hAT dimerisation domain-containing protein / transposase-related low similarity to transposase [Ipomoea purpurea] AB004906 GI:4063770 Length = 382 Score = 27.9 bits (59), Expect = 6.8 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 5/119 (4%) Frame = -3 Query: 570 QLF*GTLFQVRFL--FEESDNHYSSLEVKASKSATVRSSLELGPTWARMYL---TMPLDS 406 Q+F G LF V+ L E+ + S ++++AS V S ++ + + L +P + Sbjct: 256 QIF-GFLFGVKRLKVAEDDELRTSCMKLEASLKHDVHSDVDGEDLFMELKLLKDVLPKEI 314 Query: 405 LGPLYSEESSPFLKIFSVGYPDTENCSQVLLPPSVQSTLASATGGSSVFNSRRLQRTLA 229 P+ E FLKI YP+T ++LL V LA T + L+ T++ Sbjct: 315 TKPV---EVLKFLKIMDSCYPNTWIAYRILLTIPVSVALAERTFSKLKLIKKYLRSTMS 370 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 150 FSAVLSQHDTALVMFYAPWCGHCKRLKP 233 F+ + + +V F A WCG C+ ++P Sbjct: 40 FNEIKESNKLLVVDFSASWCGPCRMIEP 67 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = +2 Query: 260 KTDDPPVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPR 406 K DD V K+DC + ++ + PT KI + ++ E G + Sbjct: 115 KYDD--VVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAK 161 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 150 FSAVLSQHDTALVMFYAPWCGHCKRLKP 233 F ++ + ++ F A WCG CK ++P Sbjct: 36 FDSMKGSNKLLVIDFTAVWCGPCKAMEP 63 >At1g08060.2 68414.m00881 MOM1 identical to MOM1 (mutation in a 'Morpheus molecule') [Arabidopsis thaliana] gi|8132770|gb|AAF73381.1| Length = 2001 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 697 EESSNLFWSRLGRYKTTLFLYP 632 EES N+FWS+L K ++ YP Sbjct: 807 EESPNIFWSKLLGGKNPMWKYP 828 >At1g08060.1 68414.m00880 MOM1 identical to MOM1 (mutation in a 'Morpheus molecule') [Arabidopsis thaliana] gi|8132770|gb|AAF73381.1| Length = 2001 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 697 EESSNLFWSRLGRYKTTLFLYP 632 EES N+FWS+L K ++ YP Sbjct: 807 EESPNIFWSKLLGGKNPMWKYP 828 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,985,742 Number of Sequences: 28952 Number of extensions: 305332 Number of successful extensions: 962 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 953 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -