BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20506 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 2.8 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.8 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 3.7 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 3.7 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 4.9 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 4.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 4.9 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 4.9 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 4.9 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 4.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 6.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.6 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 473 STLTLKYLDEY-SGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 315 + L ++ +D SG +I G+ + +++ +G L +S S+NT+ G Y Sbjct: 330 NALEMRLMDAIDSGYLIDEYGKKIDIYTPEGLNMLGNVIEGSSDSINTKFYGMY 383 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 421 TLITNPEYSSKYLR 462 T I N YSSKY+R Sbjct: 199 TYIVNTNYSSKYMR 212 Score = 23.0 bits (47), Expect = 2.8 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -1 Query: 473 STLTLKYLDEY-SGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 315 + L ++ +D SG +I G+ + +++ +G L S S+NT+ G Y Sbjct: 330 NALEMRLMDAIDSGYLIDEYGKKIDIYTPEGLNMLGNVIEGNSDSINTKFYGMY 383 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 537 PRGAGGIPVSRIYRAS 490 PRG GG+P S I A+ Sbjct: 399 PRGPGGVPTSVIQAAT 414 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -1 Query: 446 EYSGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEG 327 E+ G+ +G ++L SG+ LD GH S+ G Sbjct: 174 EFGGITQCIGAFDVTLESGERVTFLDTPGHAAFISMRHRG 213 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 124 HDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDE 231 +D ++VGG V L + N K L PDE Sbjct: 69 YDFIVVGGGAARAVVAGRLSEVSNWKVLLLEAGPDE 104 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 178 LQDFFNGKELNKSINPDEAVAYGAAVRLLSC 270 +QD F+ + K+++ + + +G A LSC Sbjct: 297 VQDVFDSQLTVKAVSKNGVLLFGLANNTLSC 327 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 634 HYQRQRSSLQGRDRAY 681 HY R+RS + R+R Y Sbjct: 230 HYSRERSCSRDRNREY 245 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 634 HYQRQRSSLQGRDRAY 681 HY R+RS + R+R Y Sbjct: 230 HYSRERSCSRDRNREY 245 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 634 HYQRQRSSLQGRDRAY 681 HY R+RS + R+R Y Sbjct: 230 HYSRERSCSRDRNREY 245 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 634 HYQRQRSSLQGRDRAY 681 HY R+RS + R+R Y Sbjct: 230 HYSRERSCSRDRNREY 245 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 634 HYQRQRSSLQGRDRAY 681 HY R+RS + R+R Y Sbjct: 219 HYSRERSCSRDRNREY 234 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 634 HYQRQRSSLQGRDRAY 681 HY R+RS + R+R Y Sbjct: 230 HYSRERSCSRDRNREY 245 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 6.5 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 574 QRYPQRFRYREVHQ-QGEQDHHYQRQRSSLQGRDR 675 +RY R R RE + + E+++ R+RS + RDR Sbjct: 270 KRY-SRSREREQNSYKNEREYRKYRERSKERSRDR 303 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 376 VTLPSPLNRLRHSPP 420 +T PSP R R++PP Sbjct: 986 MTDPSPFKRGRYTPP 1000 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,915 Number of Sequences: 438 Number of extensions: 4001 Number of successful extensions: 16 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -