BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20504 (671 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) 130 1e-30 >SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 130 bits (314), Expect = 1e-30 Identities = 58/89 (65%), Positives = 71/89 (79%) Frame = +1 Query: 256 VSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRY 435 V+I+KT E FRL+YDVKGRF +HRIT EEAKYKL +V+RV G K VPY+VTHD RTIRY Sbjct: 514 VTIDKTGENFRLLYDVKGRFAVHRITAEEAKYKLGRVRRVDVGAKGVPYIVTHDARTIRY 573 Query: 436 PDPLIKVNDSIQLDIATTKIMDFISLSLG 522 PDP IKVND++ +DI T K++D+I G Sbjct: 574 PDPNIKVNDTVVIDIKTGKVIDYIKFDTG 602 Score = 114 bits (274), Expect = 7e-26 Identities = 50/60 (83%), Positives = 54/60 (90%) Frame = +3 Query: 3 PKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNES*KL 182 PKKH+KRLNAPK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL G E K+ Sbjct: 429 PKKHMKRLNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEEVKKI 488 Score = 90.6 bits (215), Expect = 1e-18 Identities = 35/55 (63%), Positives = 47/55 (85%) Frame = +3 Query: 507 QFESGNLCMITGGRNLGRVGTIVSRERHPGSFDIVHIKDSTGHTFATRLNNVFII 671 +F++GN+ M+ GGRN+GRVG + RE+H GSFDIVH+KD+TGH FATRL N+F+I Sbjct: 598 KFDTGNMAMVVGGRNMGRVGMVTHREKHAGSFDIVHVKDATGHQFATRLTNIFVI 652 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 164 KRILKIVKQRLIKVDGKVRTDPTYPAGFMDV 256 + + KIVKQRLIK+DGKVRTD TYPAGFMDV Sbjct: 483 EEVKKIVKQRLIKIDGKVRTDTTYPAGFMDV 513 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,916,915 Number of Sequences: 59808 Number of extensions: 529239 Number of successful extensions: 1528 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1523 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -