BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20503 (647 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0527 - 4177928-4178235,4178849-4181438 30 1.8 07_03_1631 - 28258897-28259984,28260518-28260772,28260861-282609... 29 3.2 02_02_0392 - 9649858-9650405,9650499-9650670,9650788-9650926,965... 29 3.2 05_04_0203 + 19016547-19016860,19017020-19017169,19017946-190180... 29 4.2 02_02_0396 - 9756993-9757540,9757590-9757809,9757929-9758046,975... 28 5.6 01_05_0752 - 24909954-24910502,24914620-24914786,24914916-249149... 28 7.4 >12_01_0527 - 4177928-4178235,4178849-4181438 Length = 965 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/37 (35%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -3 Query: 111 LSVSTIADVRRLTSNRH-YSRFVMSLIHKNIKMMNMT 4 +SVS +A + R +N++ ++ F+ S I KN+KM++++ Sbjct: 276 VSVSNVASLARFAANQNNFTGFIPSGITKNVKMLDLS 312 >07_03_1631 - 28258897-28259984,28260518-28260772,28260861-28260975, 28261097-28261149,28261238-28261498,28262122-28262175, 28262294-28262536,28262830-28263073,28263877-28263909 Length = 781 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/48 (22%), Positives = 27/48 (56%) Frame = +3 Query: 453 RRNRFIISHM*SNIQKSSRLYDVHIIVAIGKFCELRAQKILDKYSFRN 596 R R I+ + ++QK ++ H++++I KF ++ A++ S+ + Sbjct: 587 RMYRCIVRYGYKDVQKDDENFENHLVMSIAKFIQMEAEEAASSGSYES 634 >02_02_0392 - 9649858-9650405,9650499-9650670,9650788-9650926, 9651113-9651334,9651422-9651495,9653042-9653661, 9653810-9653965,9655250-9655347,9655443-9655534, 9655891-9655977 Length = 735 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 352 EPNKFFESSFVYNYLPEQWMKNNGCNLTPGDFKAAEIDSLYHI 480 EPNK + VY+ P+ + K C+L P + + + LY + Sbjct: 585 EPNKAIDPGLVYDIDPKDYTKFFNCSLDPQEDCKSYMGKLYQL 627 >05_04_0203 + 19016547-19016860,19017020-19017169,19017946-19018081, 19018222-19018323,19018556-19018675,19018800-19018880, 19019041-19019381,19020296-19020589,19020701-19021025, 19021167-19021400,19021506-19021760 Length = 783 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 226 QPISD*RNFTKWNLQGTRCYPSS 158 QPI+D F KW L+GTR P S Sbjct: 31 QPINDRVYFPKWYLKGTRSSPRS 53 >02_02_0396 - 9756993-9757540,9757590-9757809,9757929-9758046, 9758156-9758431,9758569-9758609 Length = 400 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +1 Query: 352 EPNKFFESSFVYNYLPEQWMKNNGCNLTPGDFKAAEIDSLYHI 480 +P+K + VY+ P+++ K C L P D + + LY + Sbjct: 250 DPDKSIDPGLVYDIDPKEYTKFFNCTLGPKDDCESYVGQLYQL 292 >01_05_0752 - 24909954-24910502,24914620-24914786,24914916-24914979, 24915472-24915597,24915673-24915943,24916032-24916287, 24916386-24916754,24916850-24916891,24917474-24917682, 24918074-24918109,24918509-24918918,24919314-24919438, 24920267-24920333,24921596-24921652 Length = 915 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 286 FDCKRTEVSGKRFWGLFKNLCGEPNK 363 FD ++ +V G FW L +NL P K Sbjct: 606 FDFRQGDVKGNPFWKLVRNLLKTPGK 631 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,042,504 Number of Sequences: 37544 Number of extensions: 344905 Number of successful extensions: 691 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -