BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20503 (647 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF068711-1|AAC17775.2| 1121|Caenorhabditis elegans Hypothetical ... 29 2.8 L07144-12|AAM54162.1| 1053|Caenorhabditis elegans Hypothetical p... 28 5.0 >AF068711-1|AAC17775.2| 1121|Caenorhabditis elegans Hypothetical protein R09A1.1 protein. Length = 1121 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +1 Query: 277 VNGFDCKRTEVSGKRFWGLFKNLCGEPNKFFESSFVYNYLPEQWMKN 417 +NG + E+ G RFW + K +P + +++N + W N Sbjct: 216 INGKSSNKRELCGPRFWEILKE--NKPTFGMPNQYIFNDVNMMWSTN 260 >L07144-12|AAM54162.1| 1053|Caenorhabditis elegans Hypothetical protein R05D3.1 protein. Length = 1053 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 284 DLIVKELK*VGNDSGDCSRIYVENQTNFLNLV 379 DL K LK + + + IYVENQ NF+ +V Sbjct: 923 DLYEKRLK-IQKEECEAKLIYVENQLNFIEMV 953 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,453,966 Number of Sequences: 27780 Number of extensions: 340023 Number of successful extensions: 760 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -