BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20502 (480 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0212 - 1668776-1669105 32 0.21 05_04_0436 + 21226656-21226695,21226819-21226934,21227059-212272... 29 2.6 >03_01_0212 - 1668776-1669105 Length = 109 Score = 32.3 bits (70), Expect = 0.21 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 170 REMIAKEEDLISARIPNKYRDYCAHYLLAIKFVAIKKCR 286 + IA + ++ AR+P YRD CAH L + + KCR Sbjct: 15 KPQIATQAEMSEARLPLPYRDQCAHLL-----IPLNKCR 48 >05_04_0436 + 21226656-21226695,21226819-21226934,21227059-21227210, 21227309-21227394,21227999-21228126,21228267-21228317, 21228574-21228660,21229418-21229487,21230334-21230470, 21230855-21230932,21231912-21231998 Length = 343 Score = 28.7 bits (61), Expect = 2.6 Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = -1 Query: 468 ILFTYLTPLTTLVFNDLGSSTNPIFPYSKATFPFKFLHT*NVIL--LFAIQIIVFLMGAS 295 I + + TP+ V + +FP A PF L ++++ +F + F + Sbjct: 199 IFWVFFTPVMVSVAKSFDAPIKLLFPTGDAARPFSMLGLGDIVIPGIFVALALRFDVSRG 258 Query: 294 IKKRHF 277 IK R+F Sbjct: 259 IKNRYF 264 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,447,388 Number of Sequences: 37544 Number of extensions: 178711 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -