BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20502 (480 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48231| Best HMM Match : TUDOR (HMM E-Value=1.9e-28) 29 2.0 SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 >SB_48231| Best HMM Match : TUDOR (HMM E-Value=1.9e-28) Length = 1282 Score = 29.1 bits (62), Expect = 2.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 49 SIHYHHGANYGRISCSLCGPEF 114 S+H HGANYG + + P++ Sbjct: 464 SVHIQHGANYGNVDSFISEPDY 485 >SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4994 Score = 27.1 bits (57), Expect = 8.0 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +2 Query: 134 DPQAGFQYERKQREMIAKEEDLISARIPNKYRDYCAH 244 DP+ FQ+ +K E+L +++ N Y+ H Sbjct: 1032 DPRGTFQHTKKTERAATSNEELAPSKLKNYYKAISEH 1068 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,498,350 Number of Sequences: 59808 Number of extensions: 225168 Number of successful extensions: 569 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -