BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20501 (658 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 25 0.72 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.9 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 24.6 bits (51), Expect = 0.72 Identities = 20/65 (30%), Positives = 26/65 (40%) Frame = +3 Query: 141 RER*KSRTKHTSYKILSNS*LNG*LHTRITSVRDAKLNRRLRPLGAFCNIKDERIAAMQH 320 R + K TK T + S LH TS+ DA N +PL NI+ R Sbjct: 235 RMKAKKDTKFTEQSVTSTFDFLS-LHPAETSMNDANRNDCAKPLTQIRNIRGPRKRLRFA 293 Query: 321 YPVKT 335 Y +T Sbjct: 294 YVTRT 298 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 106 PTKPGPLPPST 74 PTKP PPST Sbjct: 1169 PTKPSYRPPST 1179 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,100 Number of Sequences: 336 Number of extensions: 2552 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -