BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20501 (658 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr... 30 0.34 SPBP4H10.03 |oxa102|oxa1, oxa1-2, oxa1sp2|mitochondrial inner me... 25 7.3 >SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 29.9 bits (64), Expect = 0.34 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = -1 Query: 208 PFSYEFDRIL*DVCLVRLFQRSR*RKS*LNFVWSPTKPGPLPP---STGYPQIDSPALKK 38 P +F+ L +C FQ + S L W KP PLPP S G P I +P + Sbjct: 82 PSFLQFNGQLKALCNNSAFQALPIKLSDLQKHWPSLKPHPLPPKRVSLGIPSISNPPVDT 141 Query: 37 ATSE 26 S+ Sbjct: 142 VISD 145 >SPBP4H10.03 |oxa102|oxa1, oxa1-2, oxa1sp2|mitochondrial inner membrane translocase Oxa102|Schizosaccharomyces pombe|chr 2|||Manual Length = 409 Score = 25.4 bits (53), Expect = 7.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 15 FSSYSLVAFFNAGESICGYPVEGGNGPGF 101 F ++FF A +++ G PVEG GF Sbjct: 197 FQGILFISFFYALKTMAGVPVEGFTDGGF 225 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,391,180 Number of Sequences: 5004 Number of extensions: 43506 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -