BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20501 (658 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039039-3|AAB94175.3| 161|Caenorhabditis elegans Hypothetical ... 29 3.8 Z47072-3|CAI79221.1| 126|Caenorhabditis elegans Hypothetical pr... 27 8.9 AF077538-1|AAC64622.1| 1275|Caenorhabditis elegans Hypothetical ... 27 8.9 >AF039039-3|AAB94175.3| 161|Caenorhabditis elegans Hypothetical protein T08B1.4 protein. Length = 161 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 61 FADTRSRGVTDRVLWDSIQN*VNFYAIGNVERVGLSTHLI 180 F TRS+ W S+ ++F+ +G V R L+ HL+ Sbjct: 92 FRGTRSKSQLFLEGWQSVGTGIDFFDMGEVNRYFLNAHLV 131 >Z47072-3|CAI79221.1| 126|Caenorhabditis elegans Hypothetical protein F26C11.4 protein. Length = 126 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 24 YSLVAFFNAGESICGYPVEGGN 89 +S + F G+S CGYPV+ N Sbjct: 12 FSSLVFMTNGQSCCGYPVDAIN 33 >AF077538-1|AAC64622.1| 1275|Caenorhabditis elegans Hypothetical protein H02F09.3 protein. Length = 1275 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 196 RS*TVDCTHVLHLYEMRN*IADSAHSAPFVISKMKGSRQCNITL*KRVSLCQL 354 R DC+ + ++RN + SA A F+++ G+ L K+++L QL Sbjct: 68 RDANTDCSFNANKNQLRNFLTSSAEDANFILTTYSGTSTKTEPLTKQLALDQL 120 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,101,954 Number of Sequences: 27780 Number of extensions: 243762 Number of successful extensions: 607 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 606 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -