BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20475 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 1.9 SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) 28 5.8 >SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1565 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 427 EDAIENVVFICTPRSDGFS-VFRCITGQSREPSFASLLLPVFKNI 296 ED++ + + IC P + G+S ++C+ + FA+ L V N+ Sbjct: 693 EDSMGSPLIICEPNNRGYSGTYKCVATNKLDTDFATGSLNVLGNV 737 >SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 434 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 391 PRSDGFSVFRCITGQSREPSFASLLLP 311 P S+ + VFRC R PS +LL+P Sbjct: 330 PPSNSWHVFRCSRQHPRPPSSVTLLIP 356 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,084,922 Number of Sequences: 59808 Number of extensions: 290990 Number of successful extensions: 654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -