BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20475 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 26 0.71 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 6.6 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 26.2 bits (55), Expect = 0.71 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 228 YYCSIYERCSVVLLFTRALALASNLNWVDI 139 YY I C VVLLF + L L NL +D+ Sbjct: 7 YYNIISPPCRVVLLFAKWLKLELNLIELDV 36 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.0 bits (47), Expect = 6.6 Identities = 10/42 (23%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 348 NLESLVLHLCFYRC-SKIYLHLTSLMEHLPLNDLPFNVHYKY 226 N++ + +++ + C ++ H SL L ++LP ++H Y Sbjct: 504 NIDDININVEAFPCVDEVLKHELSLEGSLDFSNLPLSIHNSY 545 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 527,651 Number of Sequences: 2352 Number of extensions: 9430 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -