BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20467 (832 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 5.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.9 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 260 SQLKDHRRLGSGPCVEGST 204 SQ + RR S PC G+T Sbjct: 180 SQSPNRRRASSNPCHNGAT 198 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 6.9 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 501 EVRAGPNLTVADLSLIASVSSLEASDIDFKKYANVKR 611 E R+ NLT SLI S E S + NV R Sbjct: 30 EKRSSENLTEEKSSLIDLTESEEKSGGSYSSNKNVSR 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,482 Number of Sequences: 336 Number of extensions: 3667 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22829180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -