BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20467 (832 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 32 0.54 At5g41220.1 68418.m05009 glutathione S-transferase, putative sim... 30 1.6 At2g30870.1 68415.m03762 glutathione S-transferase, putative sup... 30 1.6 At1g21510.1 68414.m02690 hypothetical protein 30 1.6 At1g02940.1 68414.m00261 glutathione S-transferase, putative sim... 30 1.6 At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-... 29 2.9 At3g03190.1 68416.m00315 glutathione S-transferase, putative ide... 29 2.9 At2g30860.1 68415.m03761 glutathione S-transferase, putative ide... 29 2.9 At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) fa... 29 3.8 At2g02390.2 68415.m00177 glutathione S-transferase zeta 1 (GSTZ1... 29 3.8 At2g02390.1 68415.m00178 glutathione S-transferase zeta 1 (GSTZ1... 29 3.8 At5g41240.1 68418.m05011 glutathione S-transferase, putative sim... 29 5.0 At4g30900.1 68417.m04388 expressed protein 28 6.6 At2g02380.1 68415.m00176 glutathione S-transferase, putative sim... 28 6.6 At1g25400.1 68414.m03153 expressed protein similar to unknown pr... 28 6.6 At5g52530.2 68418.m06518 dentin sialophosphoprotein-related cont... 28 8.7 At5g52530.1 68418.m06517 dentin sialophosphoprotein-related cont... 28 8.7 At3g26570.2 68416.m03317 phosphate transporter family protein co... 28 8.7 At3g26570.1 68416.m03316 phosphate transporter family protein co... 28 8.7 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 31.9 bits (69), Expect = 0.54 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -3 Query: 686 SLECLQSFLVGLLVTRSCTLNRLVPSLNVGVFLE 585 ++ CL FLV L+V+++ T R P+ NVG L+ Sbjct: 2 AVRCLAVFLVALMVSQAVTATRPAPTKNVGAGLD 35 >At5g41220.1 68418.m05009 glutathione S-transferase, putative similar to emb|CAA10662 Length = 590 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 6/52 (11%) Frame = +3 Query: 525 TVADLSLIASVSSLEASDID-----FKKYANVKRWYE-TVKSTAPGYQEANE 662 ++ADLSL+ ++ L+ D + NV++W E T K+T P + E +E Sbjct: 166 SIADLSLVCELTQLQVLDDKDRLRLLSPHKNVEQWIENTRKATMPHFDEVHE 217 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 179 EQLKPEYLKLNPQHTVPTLVDDGL 250 +QL PE+ +NP VP +VD L Sbjct: 39 QQLSPEFKDINPMGKVPAIVDGKL 62 >At2g30870.1 68415.m03762 glutathione S-transferase, putative supported by cDNA GI:443698 GB:D17673 Length = 215 Score = 30.3 bits (65), Expect = 1.6 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 8/92 (8%) Frame = +1 Query: 256 WESRAIITYLVNKY-AKGSSLYPEDPKARVLVDQRLYFDIGTLYQRFSDYFYPQVFA--- 423 +ESRAI+ Y+ KY ++G L + + R V+Q L + + + VFA Sbjct: 64 FESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLM 123 Query: 424 GAPAD----KAKNEKVQEALQLLDKFLEGQKY 507 G PAD K EK+ E L + + L +Y Sbjct: 124 GFPADEKVIKESEEKLAEVLDVYEAQLSKNEY 155 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 176 GEQLKPEYLKLNPQHTVPTLVD 241 GEQ +PEYL + P +P LVD Sbjct: 37 GEQRQPEYLAIQPFGKIPVLVD 58 >At1g21510.1 68414.m02690 hypothetical protein Length = 323 Score = 30.3 bits (65), Expect = 1.6 Identities = 21/71 (29%), Positives = 35/71 (49%) Frame = -1 Query: 634 VLLTVSYHLLTLAYFLKSMSEASRLETLAMRLRSATVRFGPARTSDLRGTCPAAEGLPVP 455 V+++ S + LT +LKS S + R E ++ S + RFG A S +C + L + Sbjct: 206 VVISSSSNSLTKGKYLKSPSPSRRYEGNFLKSPSPSRRFGVAAASLTVSSCVRKDSLDLS 265 Query: 454 SRSWPCRLGHR 422 R C + +R Sbjct: 266 GRK-ICHMSNR 275 >At1g02940.1 68414.m00261 glutathione S-transferase, putative similar to glutathione S-transferase GI:860955 from [Hyoscyamus muticus] Length = 256 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 176 GEQLKPEYLKLNPQHTVPTLVDDGL 250 G+Q KP +L +NP VP +D GL Sbjct: 74 GDQKKPSFLAINPFGQVPVFLDGGL 98 >At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-1, Zea mays, EMBL:X58573 Length = 235 Score = 29.5 bits (63), Expect = 2.9 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +1 Query: 202 EVEPSTHGPDPSRRWSFNWESRAIITYLVNKYAKGSSLYPEDPKARVLVDQRL-YFD--I 372 +V P P ES +I YL N + +G SLYPED R D+ L Y D + Sbjct: 73 KVYPENKVPALEHNGKIIGESLDLIKYLDNTF-EGPSLYPEDHAKREFGDELLKYTDTFV 131 Query: 373 GTLY 384 T+Y Sbjct: 132 KTMY 135 >At3g03190.1 68416.m00315 glutathione S-transferase, putative identical to glutathione S-transferase GB:AAB09584 from [Arabidopsis thaliana] Length = 214 Score = 29.5 bits (63), Expect = 2.9 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +1 Query: 256 WESRAIITYLVNKYA-KGSSLYPEDPKARVLVDQRLYFDIGTLYQRFSDYFYPQVF---A 423 +ESRAI Y KYA +G+ L + + R +VDQ + + Y VF + Sbjct: 65 FESRAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKS 124 Query: 424 GAPADKAKNEKVQ 462 G P D A E+++ Sbjct: 125 GKPCDVALVEELK 137 >At2g30860.1 68415.m03761 glutathione S-transferase, putative identical to GB:Y12295 Length = 215 Score = 29.5 bits (63), Expect = 2.9 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 8/92 (8%) Frame = +1 Query: 256 WESRAIITYLVNKY-AKGSSLYPEDPKARVLVDQRLYFDIGTLYQRFSDYFYPQVFA--- 423 +ESRA++ Y+ KY ++G L + + R V+Q L + T + + +FA Sbjct: 64 FESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVM 123 Query: 424 GAPAD----KAKNEKVQEALQLLDKFLEGQKY 507 G P+D K EK+ L + + L KY Sbjct: 124 GFPSDEKLIKESEEKLAGVLDVYEAHLSKSKY 155 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 176 GEQLKPEYLKLNPQHTVPTLVD 241 GE +P YL L P TVP +VD Sbjct: 37 GEHKQPAYLALQPFGTVPAVVD 58 >At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 302 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = +1 Query: 94 LCALQGCTADGEGAQLKPEPQTGRPTPRGTAQTRIFEVEPSTHGPDPSRRWSFNWESRAI 273 LC + C GE + L PEP T + +F+ T+ PSR WS + Sbjct: 136 LCRVDLCLQPGERSYLNPEPDLVEST-----NSHLFDGVTWTNRNRPSRSWSTRLSQCRV 190 Query: 274 ITYLVNK-YAKGSSL 315 L+++ ++ G S+ Sbjct: 191 SQILISRSHSTGHSV 205 >At2g02390.2 68415.m00177 glutathione S-transferase zeta 1 (GSTZ1) (GST18) identical to SP|Q9ZVQ3|GTZ1_ARATH Glutathione S-transferase zeta-class 1 (EC 2.5.1.18) (AtGSTZ1) (Maleylacetone isomerase) (EC 5.2.1.-) (MAI) {Arabidopsis thaliana}; contains Pfam profiles PF02798: Glutathione S-transferase, N-terminal domain and PF00043:Glutathione S-transferase, C-terminal domain Length = 191 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 176 GEQLKPEYLKLNPQHTVPTLVD 241 G+Q ++ K+NP TVP LVD Sbjct: 44 GDQFDSDFKKINPMGTVPALVD 65 >At2g02390.1 68415.m00178 glutathione S-transferase zeta 1 (GSTZ1) (GST18) identical to SP|Q9ZVQ3|GTZ1_ARATH Glutathione S-transferase zeta-class 1 (EC 2.5.1.18) (AtGSTZ1) (Maleylacetone isomerase) (EC 5.2.1.-) (MAI) {Arabidopsis thaliana}; contains Pfam profiles PF02798: Glutathione S-transferase, N-terminal domain and PF00043:Glutathione S-transferase, C-terminal domain Length = 221 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 176 GEQLKPEYLKLNPQHTVPTLVD 241 G+Q ++ K+NP TVP LVD Sbjct: 44 GDQFDSDFKKINPMGTVPALVD 65 >At5g41240.1 68418.m05011 glutathione S-transferase, putative similar to glutathione S-transferase, GST 10b GB:CAA10662 [Arabidopsis thaliana] 37349. Length = 591 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 179 EQLKPEYLKLNPQHTVPTLVDDGL 250 +QL PE+ ++NP VP +VD L Sbjct: 39 QQLSPEFKEINPMGKVPAIVDGRL 62 >At4g30900.1 68417.m04388 expressed protein Length = 254 Score = 28.3 bits (60), Expect = 6.6 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = -2 Query: 294 LVHQVGDDGAGLPVERPSSTRVGTVC*GFNFKYSGLSCSPWCRSTSLRFRFKL-SAFAVS 118 L +Q D G + PSS+ G+NF +S PW + FR L S A Sbjct: 4 LAYQEQDLGMLMMNTAPSSSTRKKAARGWNFLVVRVSLGPW--KHGMGFRSSLYSDMAAY 61 Query: 117 STALQGAEP 91 + L+GAEP Sbjct: 62 TFQLKGAEP 70 >At2g02380.1 68415.m00176 glutathione S-transferase, putative similar to gi:167970 gb:AAA72320 gb:AY052332 Length = 223 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 176 GEQLKPEYLKLNPQHTVPTLVD 241 G+Q ++ K+NP TVP LVD Sbjct: 47 GDQSDSDFKKINPMGTVPALVD 68 >At1g25400.1 68414.m03153 expressed protein similar to unknown protein GI:6714347 from [Arabidopsis thaliana] Length = 288 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -1 Query: 610 LLTLAYFLKSMSEASRLETLAMRLRSATVRFGPART 503 LL LA+F S +R++TL RLR+ V P++T Sbjct: 49 LLLLAFFASFTSLTTRIKTLVFRLRNVNVSL-PSQT 83 >At5g52530.2 68418.m06518 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 145 PEPQTGRPTPRGTAQTRIFEVEPSTHGPDPSRRWSFNWESRAII 276 PE TG T Q R E + G D RR+ FN E ++++ Sbjct: 775 PEESTGGNRFEMTQQRRTRRSETTEDGGDVIRRFKFNEEQQSVV 818 >At5g52530.1 68418.m06517 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 145 PEPQTGRPTPRGTAQTRIFEVEPSTHGPDPSRRWSFNWESRAII 276 PE TG T Q R E + G D RR+ FN E ++++ Sbjct: 775 PEESTGGNRFEMTQQRRTRRSETTEDGGDVIRRFKFNEEQQSVV 818 >At3g26570.2 68416.m03317 phosphate transporter family protein contains Pfam profile: PF01384 phosphate transporter family Length = 587 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = -1 Query: 664 FSLASW*PGAVLLTVSYHLLTLAYFLKSMSEASRLETLAMRLRSATVRFG 515 F ++S A+ + +++ LTL F+KS+ + L+T L AT+ FG Sbjct: 118 FHISSTTARAISIVIAFSALTLPIFMKSLGQGLALKT--KLLSYATLLFG 165 >At3g26570.1 68416.m03316 phosphate transporter family protein contains Pfam profile: PF01384 phosphate transporter family Length = 613 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = -1 Query: 664 FSLASW*PGAVLLTVSYHLLTLAYFLKSMSEASRLETLAMRLRSATVRFG 515 F ++S A+ + +++ LTL F+KS+ + L+T L AT+ FG Sbjct: 144 FHISSTTARAISIVIAFSALTLPIFMKSLGQGLALKT--KLLSYATLLFG 191 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,037,816 Number of Sequences: 28952 Number of extensions: 326404 Number of successful extensions: 867 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -