BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20462 (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476,936... 31 0.50 03_02_0752 - 10922456-10922644,10922719-10922796,10922888-109230... 30 1.2 01_01_0158 + 1374169-1374324,1374464-1375295,1375977-1376242 29 2.0 08_01_0679 - 5933187-5933258,5933378-5933592,5934527-5934569 27 8.2 >06_01_1133 + 9364842-9364850,9364929-9365048,9365157-9365476, 9366267-9366428,9367151-9367235,9367352-9367501, 9367588-9367635,9367705-9367773,9367897-9368600, 9369426-9369561,9369636-9369856,9370355-9370486, 9371316-9371406,9371878-9371925,9372004-9372132, 9372357-9372626 Length = 897 Score = 31.5 bits (68), Expect = 0.50 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 139 CVSQNTGTCPESSCACPEISCACPETSCACPESSC 243 C GTC E C CP++ C C C +S C Sbjct: 661 CPCLTNGTCCEKYCGCPKM-CKNRFRGCHCAKSQC 694 >03_02_0752 - 10922456-10922644,10922719-10922796,10922888-10923016, 10923105-10923152,10923243-10923333,10923517-10923648, 10923869-10924086,10925121-10925271,10925360-10926009, 10926715-10926786,10926938-10926985,10927105-10927242, 10927750-10927756,10928064-10928212 Length = 699 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 139 CVSQNTGTCPESSCACPEISCACPETSCACPESSC 243 C GTC E C C + SC C C +S C Sbjct: 464 CACVENGTCCEKYCGCSK-SCKNRFRGCHCAKSQC 497 >01_01_0158 + 1374169-1374324,1374464-1375295,1375977-1376242 Length = 417 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 142 VSQNTGTCPESSCACPEISCACPETSCA 225 ++++ TCP + C CPE C S A Sbjct: 116 ITEHEKTCPHAPCFCPEPGCGFAAASAA 143 >08_01_0679 - 5933187-5933258,5933378-5933592,5934527-5934569 Length = 109 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 145 SQNTGTCPESSCACPEISCACPETSCACPESSCLCPQ 255 S +T T + A I C T+C CP S LCPQ Sbjct: 21 SSSTATA-QPPVATAAIHFQCASTACRCPHLS-LCPQ 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,652,472 Number of Sequences: 37544 Number of extensions: 80378 Number of successful extensions: 341 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 333 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -