BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20456 (763 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schiz... 25 8.9 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 8.9 SPBC839.13c |rpl1601||60S ribosomal protein L13/L16|Schizosaccha... 25 8.9 >SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 1|||Manual Length = 197 Score = 25.4 bits (53), Expect = 8.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 475 LASALEAFRHNPADGSSHHRPLGRVHEPNVR 383 LA +A R+NP+ G+ H R R+ + VR Sbjct: 56 LAYLRKACRYNPSRGAFHFRAPSRIFQKAVR 86 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 8.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 84 SPYAY*TSGSSQLLPFCSTRGF 19 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 >SPBC839.13c |rpl1601||60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 2|||Manual Length = 197 Score = 25.4 bits (53), Expect = 8.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 475 LASALEAFRHNPADGSSHHRPLGRVHEPNVR 383 LA +A R+NP+ G+ H R R+ + VR Sbjct: 56 LAYLRKACRYNPSRGAFHFRAPSRIFQKAVR 86 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,178,782 Number of Sequences: 5004 Number of extensions: 64645 Number of successful extensions: 167 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -