BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20455 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 2.1 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 6.6 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.4 bits (48), Expect = 2.1 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +2 Query: 410 SKVIRNRLSEPGAEN---IKVICVGDKSRGILQRLYESTSLVLLMRLDVSHY 556 SK+ R+ LS+PG+ N C K +G R E LV R HY Sbjct: 148 SKIGRDELSQPGSLNGYGSSDGCDARKKKGPTPRQQEELCLVCGDRASGYHY 199 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 374 LTEVCRTVHTGVSKVIRNRLSEPG 445 L + + +H G + +IRN PG Sbjct: 562 LDQFIQNLHAGENTIIRNSQQAPG 585 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,037 Number of Sequences: 438 Number of extensions: 5150 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -