BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20453 (385 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0114 + 25958834-25961296 29 1.7 11_06_0621 + 25587476-25587604,25588230-25588423,25588800-255888... 27 5.1 >02_05_0114 + 25958834-25961296 Length = 820 Score = 28.7 bits (61), Expect = 1.7 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +1 Query: 76 YYFQCFEYLTVCVFTEIILL*FQQKFARLNL-KVVLIVIMSTACKNRNVS 222 Y QCF L + +E+I + K + L+L KV+ + M T CKN N++ Sbjct: 369 YLLQCFRKLGMT--SEVIAYFLKFKDSGLHLDKVIYNIAMDTYCKNGNMN 416 >11_06_0621 + 25587476-25587604,25588230-25588423,25588800-25588874, 25589434-25591852 Length = 938 Score = 27.1 bits (57), Expect = 5.1 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +1 Query: 76 YYFQCFEYLTVCVFTEIILL*FQQKFARLNLKVVLIVIMSTACKNRNVS 222 Y QCF L + L F+ L+ KV+ + M T CKN N++ Sbjct: 487 YLLQCFRKLGMTSEAIAYFLKFKDSGLHLD-KVIYNIAMDTYCKNGNMN 534 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,975,743 Number of Sequences: 37544 Number of extensions: 104691 Number of successful extensions: 162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 636799876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -