BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20453 (385 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_4971| Best HMM Match : Ras (HMM E-Value=0) 27 5.2 >SB_40521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 32.7 bits (71), Expect = 0.11 Identities = 20/61 (32%), Positives = 34/61 (55%) Frame = +1 Query: 61 FL*SLYYFQCFEYLTVCVFTEIILL*FQQKFARLNLKVVLIVIMSTACKNRNVSIYLLYN 240 +L +YF+ +YL + V++E + QQ F R+NL + ++S A N+ +YLL Sbjct: 9 YLHDTFYFELKQYLGITVYSEQV----QQHFRRVNLDALTCSLLSGAV---NMRLYLLQK 61 Query: 241 V 243 V Sbjct: 62 V 62 >SB_4971| Best HMM Match : Ras (HMM E-Value=0) Length = 209 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 190 MSTACKNRNVSIYLLYNVNKV*QFCHTVKWIEE 288 ++TA I L+Y+VN+ F H +W+EE Sbjct: 73 LTTAYYRSAHGIVLIYDVNESETFLHLSQWLEE 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,179,594 Number of Sequences: 59808 Number of extensions: 153038 Number of successful extensions: 243 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 243 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -