BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20450 (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 3.7 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 23 3.7 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 23 3.7 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.6 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 652 LDDVLVVSI*IYCREDSNDTGQRYSYSGSFCHEARQPGTDADSFV 786 +DD+L S ++CR+ N Y++S + H D SF+ Sbjct: 104 IDDLL--SNAVFCRDRVNPYLFYYAFSVALLHRPDTQNLDLPSFI 146 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = +3 Query: 471 SFVEMDSHEEKIYKP*GRPKNARRRTACANALRSCSARDWRRPNVASR 614 S E SHE ++ +P G R RTA ++ R++ R R Sbjct: 65 SLSENRSHEPEMERPKGASNGKRARTAYTSSQLVELEREFHRSKYLCR 112 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = +3 Query: 471 SFVEMDSHEEKIYKP*GRPKNARRRTACANALRSCSARDWRRPNVASR 614 S E SHE ++ +P G R RTA ++ R++ R R Sbjct: 85 SLSENRSHEPEMERPKGASNGKRARTAYTSSQLVELEREFHRSKYLCR 132 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 672 DDEDIVELPKPLPKDICE 619 DDED +E P P+ + E Sbjct: 479 DDEDAIEKPAPVKISVQE 496 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,467 Number of Sequences: 336 Number of extensions: 3661 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -