BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20444 (742 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 4.5 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 6.0 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 249 SSITAVGHAVGHQPTGHRKLLSGGERWRKS 160 SS+ + GH V + GH L G W+ S Sbjct: 446 SSVLSHGHRVIYSTVGHWYLDCGFGPWKPS 475 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 238 GSGACGWTSTDRT*EATKRRRALEK 164 G+ GW D E K RALEK Sbjct: 149 GTPVDGWLFGDNLSERMKTTRALEK 173 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,199 Number of Sequences: 336 Number of extensions: 3806 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -