BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20440 (444 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 25 0.32 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 22 2.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 4.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 4.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 4.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 4.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 4.0 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 20 9.2 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 25.0 bits (52), Expect = 0.32 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 320 IVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 415 +VT+W + E+I++ +L V PV+LT Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 22.2 bits (45), Expect = 2.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 289 PDPQIPHRTRNRH 327 PD +P RT NRH Sbjct: 110 PDNFLPERTANRH 122 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 4.0 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -2 Query: 404 RGVPRGRHAAHCRRYDAKSSP 342 RG P AA C + KS P Sbjct: 33 RGTPLAMLAAQCNKLSNKSPP 53 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 358 MPNLLHVIPVSDDSVFD 308 +P++ +IP DD+ D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 358 MPNLLHVIPVSDDSVFD 308 +P++ +IP DD+ D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 358 MPNLLHVIPVSDDSVFD 308 +P++ +IP DD+ D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 4.0 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 358 MPNLLHVIPVSDDSVFD 308 +P++ +IP DD+ D Sbjct: 355 LPDISEIIPTGDDTTMD 371 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 20.2 bits (40), Expect = 9.2 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 430 VEGSLSKQDGVFLGGDTQLIVEGMMPNL 347 V G + + GV+ G + Q++ PNL Sbjct: 262 VGGKVDETAGVYSGWEGQVLENMPQPNL 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,091 Number of Sequences: 336 Number of extensions: 2443 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9985735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -