BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20439 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 0.92 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 24 0.92 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 6.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.6 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.8 bits (49), Expect = 0.92 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 265 YESEPGGFSATQTEFSFPYLSNSRSRSSFLIPSTRPPTY 149 + S GG SA++ + + +LS+ L PS PP++ Sbjct: 88 FSSIGGGISASKRQRTDDWLSSPSGNVPPLTPSPGPPSH 126 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 23.8 bits (49), Expect = 0.92 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 361 + F F + A D C+ N T++L LK++I ++ Sbjct: 202 YVFDLFYLSKRASDLCNEANKTKILLVGLKIDIDQE 237 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = -3 Query: 268 FYESEPGGFSATQTEFSFPYLSNSRSRSSFLIPSTRPPTYTRVPP 134 F +P G +T T P LSN + ++ + T +PP Sbjct: 119 FESGKPSGVISTNTSPPSPILSNRFGENEEADAASNVISSTPLPP 163 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 417 VVVHSEVREEAGLTTHT 467 VVV EV EE L HT Sbjct: 864 VVVKKEVDEEERLENHT 880 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,897 Number of Sequences: 336 Number of extensions: 1902 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -