BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20439 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 50 9e-07 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 38 0.005 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 38 0.006 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 36 0.026 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.080 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 33 0.18 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 33 0.18 SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 32 0.32 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.32 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.74 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 30 1.3 SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) 30 1.3 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) 30 1.3 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 29 2.3 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 29 3.0 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 29 3.0 SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 28 4.0 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 4.0 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 27 9.2 SB_5211| Best HMM Match : 7tm_1 (HMM E-Value=0.015) 27 9.2 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 50.8 bits (116), Expect = 7e-07 Identities = 19/38 (50%), Positives = 27/38 (71%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 +RVY+G + + K ++EREF+ +G L VWVA NPPG Sbjct: 2 SRVYIGNIGDNASKREIEREFETFGPLRDVWVARNPPG 39 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +2 Query: 248 PRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 P FAF FE+ ++AEDA ++G + G +VE+++ Sbjct: 38 PGFAFCVFEDRRDAEDAVRELDGRYICGQRARVELAK 74 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 T++YVG L +LER F+K+G+L+ VWVA NPPG Sbjct: 4 TKLYVGNLGRNADSSELERAFEKFGRLSKVWVARNPPG 41 Score = 36.7 bits (81), Expect = 0.011 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +2 Query: 248 PRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 P FAF+E+E+ ++AE+A ++G + T++VE S Sbjct: 40 PGFAFVEYEDYRDAEEAVRELDGANVCDRTIRVEFS 75 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 T+VY+G L + K ++E EF YG L VWVA NPPG Sbjct: 32 TKVYIGSLGDNASKREIENEFGYYGPLKDVWVARNPPG 69 Score = 32.3 bits (70), Expect = 0.24 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = +2 Query: 248 PRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 P FAF F++ ++AEDA ++G + G ++VE+++ Sbjct: 68 PGFAFCIFDDRRDAEDAVRELDGRYICGQRVRVELAK 104 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +2 Query: 248 PRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 P FAF+EFE+ ++AEDA +G E G ++VE R Sbjct: 300 PPFAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVEFPR 336 Score = 31.5 bits (68), Expect = 0.43 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 129 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 +S RVYVG L + ++++DL F KYG + V Sbjct: 257 NSNDCRVYVGNLPQDVREKDLHDIFYKYGHIADV 290 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 37.5 bits (83), Expect = 0.006 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 + F+EFE+ ++A+DA NG EMLG + VE SR Sbjct: 38 YGFVEFEDDRDADDAVYECNGKEMLGERILVEHSR 72 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 144 RVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 RVY+G L G ++D+ R F YG+L + Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDI 32 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 37.5 bits (83), Expect = 0.006 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVE 349 +A +E+E +EA+ A A+NG EMLG + V+ Sbjct: 336 YALVEYETFKEAQSALEALNGAEMLGQNISVD 367 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 35.5 bits (78), Expect = 0.026 Identities = 13/35 (37%), Positives = 25/35 (71%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 + F+EF++ ++AEDA +NG +++G + VE S+ Sbjct: 724 YGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSK 758 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 34.7 bits (76), Expect = 0.046 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 +S F F+ F N ++A+ A ++NG E+ G TLK+ Sbjct: 97 RSRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKI 131 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 33.9 bits (74), Expect = 0.080 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 TR++VGGL I +LEREFD++G + + Sbjct: 318 TRLWVGGLGPWISIPELEREFDRFGAIRRI 347 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATL 340 KS F F+ FE +EAE+A + +NG E+ G L Sbjct: 147 KSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL 179 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 32.7 bits (71), Expect = 0.18 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 ++K F F+EFE ++ A MN +E+ G T++V +++ Sbjct: 42 TSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLAK 82 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 32.7 bits (71), Expect = 0.18 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSV 230 ++VG L E I++ED+ + F +YG++ SV Sbjct: 8 LWVGNLPENIREEDIVKHFTRYGRVESV 35 Score = 30.3 bits (65), Expect = 0.98 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSV 230 ++VGG+ + ++ +ER F +YG++ V Sbjct: 330 IWVGGVTNSLSEQQVERHFGRYGRVTKV 357 >SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 32.7 bits (71), Expect = 0.18 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +3 Query: 126 MSSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 221 M+S GT+++VG L + K DLE F YGKL Sbjct: 1 MASRGTQLFVGRLSKETKLRDLENVFYLYGKL 32 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 32.3 bits (70), Expect = 0.24 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +2 Query: 239 TKSPR-FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 T+ PR FAF+ F + + EDA + ++G E G ++KV +R Sbjct: 266 TQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQAR 306 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 32.3 bits (70), Expect = 0.24 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 +AF+ ++N +A A MNG + TLKV +R Sbjct: 70 YAFVNYDNPDDANKAVREMNGARLQNKTLKVSFAR 104 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 31.9 bits (69), Expect = 0.32 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F F+ ++N+ A++A MNG ++ LKV++ R Sbjct: 305 FGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKR 339 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 31.9 bits (69), Expect = 0.32 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F F+ ++N+ A++A MNG ++ LKV++ R Sbjct: 320 FGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKR 354 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.9 bits (69), Expect = 0.32 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 K + FIE+EN Q A DA ++MN ++ G L+V Sbjct: 238 KHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRV 272 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 K FAF+E++ + A+ A MNG + G +KV Sbjct: 141 KHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKV 175 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 + +S + F++F + A+ A MNG E+ G LK+ Sbjct: 279 TNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 315 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 257 AFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 AFI F + Q A++A +A+N +M G T+K I++ Sbjct: 54 AFILFIDRQSAQNAVAAVNKKQMFGRTIKCTIAK 87 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSVWV 236 VYVG L + DL + F++YGK+ V + Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTI 41 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSV 230 V+VG L +KK+ L++ F KYG++ SV Sbjct: 23 VFVGNLPLTLKKKALKKYFSKYGEVESV 50 >SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) Length = 486 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGS 257 VYVG + + K+D+ R F KYG + V V G+ Sbjct: 372 VYVGKISDETHKDDVWRRFRKYGPIEKVTVHFRDNGN 408 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 T +YVGGL + ++DL F ++G+L S+ Sbjct: 304 TTLYVGGLEGKVTEQDLRDHFYQFGELRSI 333 >SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) Length = 67 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLG 331 + F+EF+ +AEDA NG +MLG Sbjct: 40 YGFVEFDYSDDAEDAVYECNGKKMLG 65 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 129 SSGGTRVYVGGLVEGIKKEDLEREFDKYG 215 S+ +V++GGL G +EDL+ F YG Sbjct: 198 SANDGKVFIGGLAFGTTEEDLKEYFSTYG 226 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 144 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALN 245 +++VGGL KE L+ F KYG+L V + ++ Sbjct: 30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMD 63 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 28.7 bits (61), Expect = 3.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 144 RVYVGGLVEGIKKEDLEREFDKYGKL 221 +V++G L G+K D+ F KYG + Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTI 383 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 FAF+++ +EAE A NG ++ G+ ++V Sbjct: 249 FAFVDYATAEEAEKGQRAHNGRQVEGSNIRV 279 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 28.7 bits (61), Expect = 3.0 Identities = 8/27 (29%), Positives = 20/27 (74%) Frame = +3 Query: 144 RVYVGGLVEGIKKEDLEREFDKYGKLN 224 ++++GGL +ED+++ F ++GK++ Sbjct: 184 KIFIGGLSTNTSEEDMKKYFSQFGKVS 210 >SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 28.3 bits (60), Expect = 4.0 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLG 331 + F+EF++ ++A+D +NG +LG Sbjct: 40 YGFVEFDDYRDADDCVYDLNGRNLLG 65 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 132 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL 242 S TRVY G L ++ DLE+ YG++ + + L Sbjct: 2 SRSTRVYFGRLPRDCRERDLEKFVRGYGRVREISMKL 38 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 361 +S F F+ EN ++ ED +G E G LKV + K Sbjct: 81 RSRGFGFVTLENQEDLEDVTRKFDGFEYEGRRLKVAEASK 120 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 387 SEVGAAVTSGVVVHSEVREEAGLTTH 464 S+VG+ VT +VVH +EEA L+ H Sbjct: 35 SDVGSQVTLLLVVHESKKEEAKLSLH 60 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKL 221 T VYVG L +K +L++ F +YG + Sbjct: 615 TTVYVGNLPPDVKDYELQQMFSQYGSI 641 >SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 326 TSQYHSSRYTHLPPPASS 273 T++YH ++T LPPP+ S Sbjct: 169 TTEYHPEQHTPLPPPSKS 186 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F F+++ ++A+ A +NG + LKV SR Sbjct: 90 FGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSR 124 >SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 3/74 (4%) Frame = -3 Query: 376 AGPVPLSRDLYFQSGA*HLSTIHRATRIFRLLQVLK---FYESEPGGFSATQTEFSFPYL 206 + P+ S LY S S +++++ +++ + K Y+S P S++ + S+ Y Sbjct: 718 SSPLYKSSSLYKSSSLYKSSALYKSSPLYKCSSLCKSSSLYKSSPLHKSSSLYKSSYLYK 777 Query: 205 SNSRSRSSFLIPST 164 S+ +SSFL S+ Sbjct: 778 SSYLYKSSFLYKSS 791 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGSLS 263 T++YV L + K+ ++ F YG++ +V + + +LS Sbjct: 1157 TKLYVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLS 1197 >SB_5211| Best HMM Match : 7tm_1 (HMM E-Value=0.015) Length = 728 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 384 GSEVGAAVTSGVVVHSEVREEAGLTTHTVAAAAGR 488 G VGA++TS V +RE+ G TT+TV G+ Sbjct: 163 GVFVGASMTSVV---QRIREDLGATTYTVTCQYGK 194 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,266,679 Number of Sequences: 59808 Number of extensions: 221913 Number of successful extensions: 604 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -