BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20439 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 46 2e-05 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 46 2e-05 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 44 5e-05 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 44 8e-05 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 36 0.012 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 36 0.016 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 36 0.021 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 36 0.021 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.021 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.021 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.021 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 35 0.028 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 35 0.028 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 35 0.037 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 35 0.037 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 34 0.049 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 34 0.049 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 34 0.065 At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing ... 33 0.086 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 33 0.086 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 33 0.086 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 33 0.11 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 33 0.11 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 33 0.11 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 33 0.15 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 33 0.15 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 33 0.15 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 33 0.15 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 33 0.15 At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing ... 32 0.20 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 32 0.20 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 32 0.20 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 32 0.20 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 32 0.26 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 32 0.26 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 32 0.26 At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing ... 32 0.26 At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing ... 32 0.26 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 32 0.26 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 0.35 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 31 0.35 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 31 0.35 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 31 0.35 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 31 0.46 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 31 0.46 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 31 0.46 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 31 0.46 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 31 0.61 At1g67550.1 68414.m07696 urease, putative / urea amidohydrolase,... 31 0.61 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 30 0.80 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 30 0.80 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 30 0.80 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 30 1.1 At5g47330.1 68418.m05834 palmitoyl protein thioesterase family p... 30 1.1 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 30 1.1 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 30 1.1 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 30 1.1 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 30 1.1 At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing ... 29 1.4 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 29 1.4 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 29 1.4 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 29 1.4 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 29 1.4 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 29 1.9 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 29 1.9 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 29 1.9 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 29 1.9 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 29 1.9 At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly id... 29 1.9 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 29 1.9 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 29 1.9 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 29 2.5 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 29 2.5 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 29 2.5 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 29 2.5 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 29 2.5 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 29 2.5 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 29 2.5 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 28 3.2 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 28 3.2 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 28 3.2 At1g09230.1 68414.m01030 RNA recognition motif (RRM)-containing ... 28 3.2 At1g05510.1 68414.m00563 expressed protein 28 3.2 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 28 4.3 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 28 4.3 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 28 4.3 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 28 4.3 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 28 4.3 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 28 4.3 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 28 4.3 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 28 4.3 At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing ... 27 5.7 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 27 5.7 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 27 5.7 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 27 5.7 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 27 5.7 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 27 5.7 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 27 7.5 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 27 7.5 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 27 7.5 At5g50170.1 68418.m06213 C2 domain-containing protein / GRAM dom... 27 7.5 At5g47340.1 68418.m05835 palmitoyl protein thioesterase family p... 27 7.5 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 27 7.5 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 27 7.5 At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-bindi... 27 7.5 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 27 7.5 At2g30260.1 68415.m03684 small nuclear ribonucleoprotein U2B, pu... 27 7.5 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 27 7.5 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 27 7.5 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 27 7.5 At1g26400.1 68414.m03220 FAD-binding domain-containing protein s... 27 7.5 At5g44770.1 68418.m05487 DC1 domain-containing protein contains ... 27 9.9 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 27 9.9 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 27 9.9 At4g25110.1 68417.m03612 latex-abundant family protein (AMC2) / ... 27 9.9 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 27 9.9 At1g73130.1 68414.m08456 expressed protein 27 9.9 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 27 9.9 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 27 9.9 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 45.6 bits (103), Expect = 2e-05 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 TRVYVG L + + +LE EF +G L +VWVA PPG Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPG 39 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMN 313 + P +AF+EF++ ++A DA SA++ Sbjct: 36 RPPGYAFLEFDDERDALDAISALD 59 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 45.6 bits (103), Expect = 2e-05 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 TRVYVG L + + +LE EF +G L +VWVA PPG Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPG 39 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMN 313 + P +AF+EF++ ++A DA SA++ Sbjct: 36 RPPGYAFLEFDDERDALDAISALD 59 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 44.4 bits (100), Expect = 5e-05 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 +RVYVG L + + +LE EF +G + SVWVA PPG Sbjct: 2 SRVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPG 39 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 43.6 bits (98), Expect = 8e-05 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 +RVYVG L + + +LE EF +G + SVWVA PPG Sbjct: 2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPG 39 Score = 28.3 bits (60), Expect = 3.2 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNG 316 + P +AF++FE+ ++A DA A++G Sbjct: 36 RPPGYAFLDFEDPRDARDAIRALDG 60 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 36.3 bits (80), Expect = 0.012 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = +2 Query: 218 TKLSLGSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 T + T S A+IE+ N +EA A A+N TE+ G L VEI++ Sbjct: 376 TVVDCSITDSKHIAYIEYSNSEEAT-AALALNNTEVFGRALNVEIAK 421 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 35.9 bits (79), Expect = 0.016 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 + P +AF+EFE+ ++A+DA +G + G L+VEI+ Sbjct: 43 RPPGYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIA 80 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 126 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPG 254 MSS R +YVG L I+K ++E F KYG + + + + PPG Sbjct: 1 MSSRWNRTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPG 46 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 35.5 bits (78), Expect = 0.021 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 + P + F+EFE+ ++AEDA +G + G L+VE++ Sbjct: 43 RPPCYCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELA 80 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 248 +YVG L I++ ++E F KYG++ + + + P Sbjct: 9 IYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPP 42 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 35.5 bits (78), Expect = 0.021 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVE 349 +A IE+E +EA+ A SAMNG E+L + V+ Sbjct: 138 YALIEYEKKEEAQSAISAMNGAELLTQNVSVD 169 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 35.5 bits (78), Expect = 0.021 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 + P +AF+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 126 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPG 254 MSS +R VYVG L I++ ++E F KYG + + V PPG Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPG 46 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 35.5 bits (78), Expect = 0.021 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 + P +AF+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 126 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPG 254 MSS +R VYVG L I++ ++E F KYG + + V PPG Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPG 46 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 35.5 bits (78), Expect = 0.021 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 + P +AF+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 126 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPG 254 MSS +R VYVG L I++ ++E F KYG + + V PPG Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPG 46 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 135 GGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 G TR+YVG L + DLER F +YG++ V Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDV 40 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 +AF+EF + ++A+DA ++G + G+ + VE SR Sbjct: 46 YAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 80 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 135 GGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 G TR+YVG L + DLER F +YG++ V Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDV 40 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 +AF+EF + ++A+DA ++G + G+ + VE SR Sbjct: 46 YAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 80 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 34.7 bits (76), Expect = 0.037 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 + P +AF+EFE+ ++A+DA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELA 80 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +3 Query: 126 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPG 254 MSS +R +YVG L I++ ++E F KYG + + + + PPG Sbjct: 1 MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPG 46 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 34.7 bits (76), Expect = 0.037 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 + P +AF+EFE+ ++A+DA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELA 80 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +3 Query: 126 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPG 254 MSS +R +YVG L I++ ++E F KYG + + + + PPG Sbjct: 1 MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPG 46 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 34.3 bits (75), Expect = 0.049 Identities = 17/41 (41%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +2 Query: 239 TKSPRF-AFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 T + RF FIE+ ++++AE A A+N +E+ G +K+E+SR Sbjct: 302 TPNRRFHRFIEYYDVRDAETALKALNRSEIGGKCIKLELSR 342 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 34.3 bits (75), Expect = 0.049 Identities = 17/41 (41%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +2 Query: 239 TKSPRF-AFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 T + RF FIE+ ++++AE A A+N +E+ G +K+E+SR Sbjct: 315 TPNRRFHRFIEYYDVRDAETALKALNRSEIGGKCIKLELSR 355 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 33.9 bits (74), Expect = 0.065 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKL 221 ++VGG+ + K+DLE EF K+GK+ Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKI 276 >At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing protein Length = 748 Score = 33.5 bits (73), Expect = 0.086 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +3 Query: 129 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 S GG R++VGGL E + ++DL + F G +++V Sbjct: 6 SGGGVRLHVGGLGESVGRDDLLKIFSPMGTVDAV 39 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 33.5 bits (73), Expect = 0.086 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F FI +++ A++A + MNG ++ G LKV++ R Sbjct: 382 FGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 416 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 33.5 bits (73), Expect = 0.086 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F FI +++ A++A + MNG ++ G LKV++ R Sbjct: 373 FGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 407 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 248 GT +YV GL + +DLE F K GK+ S ++ + P Sbjct: 71 GTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEP 107 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 248 GT +YV GL + +DLE F K GK+ S ++ + P Sbjct: 70 GTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEP 106 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.1 bits (72), Expect = 0.11 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 +S F FI FE+ + + A + MNG E+ G L++ ++ Sbjct: 258 RSRGFGFISFESAENVQSALATMNGVEVEGRALRLNLA 295 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 32.7 bits (71), Expect = 0.15 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKL 221 G+R++VGGL + DLER F ++G + Sbjct: 6 GSRIFVGGLSPEVTDRDLERAFSRFGDI 33 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 32.7 bits (71), Expect = 0.15 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +2 Query: 215 KTKLSLGSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVE 349 K L S +S F FI F+ + ++A +AMNG ++ G T+ V+ Sbjct: 37 KVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVD 81 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 32.7 bits (71), Expect = 0.15 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 132 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 S G +Y+ L + + E L+ F +YG + S V LNP G Sbjct: 329 SQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQG 369 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGS 257 T VYV L + I +++L + F K+G ++S V + G+ Sbjct: 229 TNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGN 267 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 32.7 bits (71), Expect = 0.15 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 248 G +YV GL + + DLE F K GK+ V + L+P Sbjct: 44 GNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDP 80 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 32.7 bits (71), Expect = 0.15 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 248 G +YV GL + + DLE F K GK+ V + L+P Sbjct: 74 GNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDP 110 >At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, gb:D86122 Length = 785 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +2 Query: 260 FIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F+EF +++ A+ A A+N TE+ G +K+E SR Sbjct: 262 FVEFFDVRSADAALKALNRTEIAGKRIKLEHSR 294 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 32.3 bits (70), Expect = 0.20 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 +S + F+ F +EAE+A + +NG E++G + ++ S Sbjct: 234 RSSGYGFVSFATREEAENAITKLNGKEIMGRPITLKFS 271 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.3 bits (70), Expect = 0.20 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKL 221 +R++VGGL + + LE FD+YGK+ Sbjct: 12 SRIFVGGLSWDVTERQLESTFDRYGKI 38 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.3 bits (70), Expect = 0.20 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKL 221 +R++VGGL + + LE FD+YGK+ Sbjct: 12 SRIFVGGLSWDVTERQLESTFDRYGKI 38 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 31.9 bits (69), Expect = 0.26 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 352 KS F FI+FE+ + AE A AMN ++ LKV + Sbjct: 99 KSKHFGFIQFEDPEVAEIAAGAMNDYLLMEHMLKVHV 135 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 31.9 bits (69), Expect = 0.26 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +2 Query: 233 GSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVE 349 G+ KS FAF+ +E+ + A +NG +LG T+KV+ Sbjct: 72 GTGKSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKVD 110 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 31.9 bits (69), Expect = 0.26 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 T ++VGGL + EDL++ F+++G++ SV Sbjct: 304 TTIFVGGLDSSVTDEDLKQPFNEFGEIVSV 333 >At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 31.9 bits (69), Expect = 0.26 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +2 Query: 260 FIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F+EF +++ AE A A+N E+ G +KVE SR Sbjct: 293 FVEFYDVRGAEAALKALNRCEIAGKRIKVEPSR 325 >At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 31.9 bits (69), Expect = 0.26 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +2 Query: 260 FIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F+EF +++ AE A A+N E+ G +KVE SR Sbjct: 293 FVEFYDVRGAEAALKALNRCEIAGKRIKVEPSR 325 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 31.9 bits (69), Expect = 0.26 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKL 221 T+V+VGGL + E L R FD+YG + Sbjct: 24 TKVFVGGLAWETQSETLRRHFDQYGDI 50 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.5 bits (68), Expect = 0.35 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 T VYV L E +DL+ F +YGK+ S V + G Sbjct: 29 TNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEG 66 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 233 GSTKSPRFAFIEFENLQEAEDACSAMNG 316 G KS F F+ FEN +A A ++NG Sbjct: 64 GEGKSKGFGFVNFENADDAARAVESLNG 91 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 31.5 bits (68), Expect = 0.35 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 361 KS +F FI F + QEA+ A N T + + + VEI+ K Sbjct: 7 KSRQFGFIGFRSAQEAQQAIKYFNNTYLGTSLIIVEIAHK 46 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 31.5 bits (68), Expect = 0.35 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +3 Query: 129 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 S G R+YVG L + ++DL + F+ +G + V V + G Sbjct: 281 SGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDETG 322 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 180 KEDLEREFDKYGKLNSVWVALNPPG 254 KED++ E K+GKLN ++V N G Sbjct: 488 KEDVKEECSKFGKLNHIFVDKNSVG 512 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 31.5 bits (68), Expect = 0.35 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 T ++VGGL + EDL++ F ++G++ SV Sbjct: 306 TTIFVGGLDSSVTDEDLKQPFSEFGEIVSV 335 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSV 230 V+VG ++ DLER FDKYG+++ V Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRV 31 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 +AF+EF + ++A+DA ++G + G+ + VE SR Sbjct: 5 YAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 39 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 +AF+EF + ++A+DA ++G + G+ + VE SR Sbjct: 5 YAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 39 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 31.1 bits (67), Expect = 0.46 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 361 +S FAF+ N+++ ++GTE LG LKV + K Sbjct: 124 QSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADK 163 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 30.7 bits (66), Expect = 0.61 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F F+ +++ A++A MNG + G LKV++ R Sbjct: 392 FGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQLKR 426 >At1g67550.1 68414.m07696 urease, putative / urea amidohydrolase, putative similar to SP|P07374 Urease (EC 3.5.1.5) (Urea amidohydrolase) {Canavalia ensiformis}; contains Pfam profile PF01979: Amidohydrolase family Length = 838 Score = 30.7 bits (66), Expect = 0.61 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 363 GTGPAEVGSEVGAAVTSGVVV--HSEVREEAGLTTHTVAAAAGRTIVT 500 GT PA + + + A + V H++ E+G HT+ A GRTI T Sbjct: 494 GTTPAAIDNCLAVAEEYDIQVNIHTDTLNESGFVEHTINAFRGRTIHT 541 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 30.3 bits (65), Expect = 0.80 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 S +S F F+ F + EA+ A NG ++ G T+ V+ ++ Sbjct: 71 SDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAK 111 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 30.3 bits (65), Expect = 0.80 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 144 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGSLS 263 +VYVG L + + KE LE F + GK+ S V+ P S S Sbjct: 178 KVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKS 217 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 361 S +S RF F +++++A +NG + G +KV I+ K Sbjct: 113 SGRSRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVNITEK 154 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 233 GSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 G++KS F F+ F + ++ E A A+N + + G ++V Sbjct: 213 GTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRV 250 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 30.3 bits (65), Expect = 0.80 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 248 ++VG L +G +EDL++ F G++ V + NP Sbjct: 216 IFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNP 249 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 239 TKSPR-FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 361 T+ P+ F FI FE+ +A+ A A+NG + G + VE +++ Sbjct: 103 TQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAKE 144 >At5g47330.1 68418.m05834 palmitoyl protein thioesterase family protein Length = 314 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -1 Query: 327 NISVPFIALHASSASCKFSNSMKANLGDLV 238 ++SVPFI LH SA C SN+ AN L+ Sbjct: 24 SVSVPFIMLHGISAQC--SNARDANFTQLL 51 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 233 GSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 GS +S F F++F +A A AM+G +LG L++ + Sbjct: 77 GSGRSRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFA 117 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGS 257 T VYV L + I ++L++ F KYG ++S V + G+ Sbjct: 225 TNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGN 263 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 233 GSTKSPRFAFIEFENLQEAEDACSAMNG 316 G KS F F+ FEN +A A A+NG Sbjct: 259 GEGKSKGFGFVNFENSDDAARAVDALNG 286 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 132 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 S G+ +YV L E + + L F +G + S V +P G Sbjct: 324 SQGSNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPSG 364 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 215 KTKLSLGSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 KT L + K F F+ F ++A A M+G E+ G L V Sbjct: 43 KTPLDQANQKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTV 86 >At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing protein RNA-binding protein LAH1, Saccharomyces cerevisiae, PIR2:B48600; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 433 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 174 IKKEDLEREFDKYGKLNSV 230 +K+ED+E F +YGK+NSV Sbjct: 127 VKREDVESFFSQYGKVNSV 145 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 352 +S F F+ + + EAE A S M+G E+ G + V++ Sbjct: 42 RSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVKL 78 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 260 FIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F+EF ++++A A MNG E+ G + +E SR Sbjct: 253 FVEFYDVRDAARAFDRMNGKEIGGKQVVIEFSR 285 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 233 GSTKSPRFAFIEFENLQEAEDACSAMNG 316 G KS F F+ FEN ++A A A+NG Sbjct: 260 GDGKSRCFGFVNFENPEDAARAVEALNG 287 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 T VYV L E ++L+ F +YG ++S V + G Sbjct: 225 TNVYVKNLSEATTDDELKTTFGQYGSISSAVVMRDGDG 262 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKL 221 T+V+VGGL + E L + F++YG++ Sbjct: 24 TKVFVGGLAWETQSETLRQHFEQYGEI 50 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 144 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 236 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 144 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 236 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 144 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 236 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 248 V+VG L +KK+ + +EF K+G++ SV + P Sbjct: 173 VFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVP 206 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 123 TMSSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 TM G + VYVGGL I +E + R F YG + +V Sbjct: 2 TMDDGNS-VYVGGLPYDITEEAVRRVFSIYGSVLTV 36 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S + + F+ F N + A+DA M+G + G ++V Sbjct: 43 SVRGKCYGFVTFSNRRSADDAIEDMDGKSIGGRAVRV 79 >At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 260 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 209 IWKTKLSLGSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 +W+ + S S F EF + ++A+DA ++G + G+ + VE SR Sbjct: 1 MWENTPCMWSLLSSHFRNQEFGDPRDADDARHYLDGRDFDGSRITVEFSR 50 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 132 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 S + ++VGGL + +EDL + F +G++ SV Sbjct: 324 SNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSV 356 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 T VYV LVE DL+R F ++G++ S V + G Sbjct: 119 TNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEG 156 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 233 GSTKSPRFAFIEFENLQEAEDACSAMNG 316 G KS RF F+ FE + A A MNG Sbjct: 154 GEGKSRRFGFVNFEKAEAAVTAIEKMNG 181 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 126 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 215 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 126 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 215 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S +S F F+ F++ + DA MNG E+ G + V Sbjct: 43 SGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 126 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 215 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S +S F F+ F++ + DA MNG E+ G + V Sbjct: 43 SGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 126 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 215 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S +S F F+ F++ + DA MNG E+ G + V Sbjct: 43 SGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 245 SPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S +AF +++L + AC+A+NG +M TL V Sbjct: 399 SKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +2 Query: 251 RFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 +FAF+E +++EA +A S ++G GA +KV Sbjct: 287 KFAFVEMRSVEEASNAMS-LDGIIFEGAPVKV 317 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 245 SPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S +AF +++L + AC+A+NG +M TL V Sbjct: 399 SKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +2 Query: 251 RFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 +FAF+E +++EA +A S ++G GA +KV Sbjct: 287 KFAFVEMRSVEEASNAMS-LDGIIFEGAPVKV 317 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 245 SPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S +AF +++L + AC+A+NG +M TL V Sbjct: 399 SKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +2 Query: 251 RFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 +FAF+E +++EA +A S ++G GA +KV Sbjct: 287 KFAFVEMRSVEEASNAMS-LDGIIFEGAPVKV 317 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 129 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 221 S G R+YVG L G+ LE F++ GK+ Sbjct: 245 SGSGNRLYVGNLSWGVDDMALENLFNEQGKV 275 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S +S F F+ + QE + A +++NG ++ G ++V Sbjct: 286 SGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRV 322 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 129 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 221 S G R+YVG L G+ LE F++ GK+ Sbjct: 253 SGSGNRLYVGNLSWGVDDMALENLFNEQGKV 283 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 236 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 S +S F F+ + QE + A +++NG ++ G ++V Sbjct: 294 SGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRV 330 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 28.3 bits (60), Expect = 3.2 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKL 221 T+V+VGGL +++ R FD++G++ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFDQFGEI 43 >At1g09230.1 68414.m01030 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 442 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 257 AFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 361 AF++F+N A A +NG LG L+V+ + K Sbjct: 68 AFVDFKNEAFASQAHRQLNGLRFLGKVLQVQRANK 102 >At1g05510.1 68414.m00563 expressed protein Length = 241 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVW 233 G +++ G+ E I+++DLE+ YGK+ W Sbjct: 121 GGFLFMPGVPEAIQRQDLEKVAKTYGKVYHFW 152 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 85 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 123 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 21 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 59 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 254 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 87 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 125 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNG-TEMLGATLKV 346 F FI+F L+ ++ A A+NG E+ G T+KV Sbjct: 308 FGFIQFVQLEHSKAAQIALNGKLEIAGRTIKV 339 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSVWV 236 +YVGGL I ++D+ F YG++ S+ V Sbjct: 227 LYVGGLNSRIFEQDIHDHFYAYGEMESIRV 256 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNG 316 +S F F+ F N Q+A+ A + MNG Sbjct: 183 RSRGFGFVSFRNQQDAQTAINEMNG 207 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNG 316 +S F F+ F N Q+A+ A + MNG Sbjct: 191 RSRGFGFVSFRNQQDAQTAINEMNG 215 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNG 316 +S F F+ F N Q+A+ A + MNG Sbjct: 187 RSRGFGFVSFRNQQDAQTAINEMNG 211 >At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 355 KS +FA+I F QEA+DA + +N + + VE++ Sbjct: 41 KSRQFAYIGFRTEQEAQDAITYVNKCFIDTYRISVEVA 78 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKL 221 GT++Y+ L G+ ED++ F + G L Sbjct: 107 GTKLYISNLDYGVSNEDIKELFSEVGDL 134 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 236 T VYV L+E + + L F +YG ++SV V Sbjct: 202 TNVYVKNLIETVTDDCLHTLFSQYGTVSSVVV 233 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSV 230 VYVG + DLER F K+G++ V Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRV 31 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 129 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 221 + G RVYVG L G+ LE F + GK+ Sbjct: 200 AGSGNRVYVGNLSWGVDDMALESLFSEQGKV 230 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 +S F F+ ++ E E A NG E+ G L+V Sbjct: 130 RSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRV 164 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 254 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEISRK 361 +AF+ F+N ++A A +NGT+ L V ++K Sbjct: 243 YAFVNFDNPEDARRAAETVNGTKFGSKCLYVGRAQK 278 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKL 221 T++YVGGL +KE L F ++G++ Sbjct: 13 TKIYVGGLPWTTRKEGLINFFKRFGEI 39 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSV 230 V+ G ++ DLER F KYGK+ V Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERV 31 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSV 230 V+ G ++ DLER F KYGK+ V Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERV 31 >At5g50170.1 68418.m06213 C2 domain-containing protein / GRAM domain-containing protein low similarity to SP|P40748 Synaptotagmin III (SytIII) {Rattus norvegicus}; contains Pfam profiles PF00168: C2 domain, PF02893: GRAM domain Length = 1027 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -2 Query: 185 FLLDSLDETADVHASTTRTHGLVLFMKIQLKFIYVNKN 72 FL + DE AD+ + H K+QL+ NKN Sbjct: 626 FLKHTADELADLSVALVGNHAQASQSKLQLRIFLENKN 663 >At5g47340.1 68418.m05835 palmitoyl protein thioesterase family protein Length = 317 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 339 KVAPNISVPFIALHASSASCKFSNSMKANLGDLV 238 KV ++SVPFI LH ++ C S+ AN L+ Sbjct: 19 KVDISVSVPFIMLHGIASQC--SDDTNANFTQLL 50 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 27.1 bits (57), Expect = 7.5 Identities = 7/32 (21%), Positives = 19/32 (59%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 236 TR++V + + + D F++YG++ +++ Sbjct: 91 TRIFVARIPSSVSESDFRSHFERYGEITDLYM 122 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGS 257 G +++VG L + +DL F ++G + ++ +P S Sbjct: 239 GNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRS 278 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 129 SSGGTR---VYVGGLVEGIKKEDLEREFDKYGKLNSVWV 236 + GG R ++VGGL I + + + FD++G + V V Sbjct: 115 NGGGARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVV 153 >At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-binding protein RBP37, Arabidopsis thaliana, PIR:T04196 Length = 353 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 251 RFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 RFAFIEF N +E A +M+GT + LKV Sbjct: 209 RFAFIEFTN-EEGARAALSMSGTVLGFYPLKV 239 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 132 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 230 S ++VGG+ + EDL + F ++G++ SV Sbjct: 318 STNATIFVGGIDPDVIDEDLRQPFSQFGEVVSV 350 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +2 Query: 260 FIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F++F + + AEDA ++NGT + T+++ R Sbjct: 360 FVQFADRKSAEDAIESLNGTVIGKNTVRLSWGR 392 >At2g30260.1 68415.m03684 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative similar to spliceosomal protein [Solanum tuberosum] GI:169589 Length = 232 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLERE----FDKYGKLNSVWVALNPP 251 +Y+ L E IKKE+L+R F ++G++ V VAL P Sbjct: 12 IYIQNLNERIKKEELKRSLYCLFSQFGRILDV-VALKTP 49 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 +S F F+ F++ + +DA MNG ++ G ++ V Sbjct: 47 RSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITV 81 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 242 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 346 +S F F+ F++ + +DA MNG ++ G ++ V Sbjct: 47 RSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITV 81 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 260 FIEFENLQEAEDACSAMNGTEMLGATLKVEISR 358 F+EF ++++A A MNG + G + ++ SR Sbjct: 223 FVEFFDVRDAAKALRVMNGKVISGKPMVIQFSR 255 >At1g26400.1 68414.m03220 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 527 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 174 IKKEDLEREFDKYGKLNSVWVALNPPGSL 260 I KE LE+ + K N VW+ NP G + Sbjct: 380 IPKEGLEKIWKTMLKFNFVWIEFNPYGGV 408 >At5g44770.1 68418.m05487 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 541 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 339 KVAPNISVPFIALHASSASCKFSNSMKANLGDLV 238 +V PN ++ CKFS MK LGDLV Sbjct: 495 EVLPNNGATRPFCNSCKVRCKFSFLMKQTLGDLV 528 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 138 GTRVYVGGLVEGIKKEDLEREFDKYGKL 221 GTR++V L +G+ ED+ F + G++ Sbjct: 92 GTRLHVTNLDQGVTNEDIRELFSEIGEV 119 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 260 FIEFENLQEAEDACSAMNGTEMLGATLKV 346 +IEF ++++A+ A +NG E+ G LK+ Sbjct: 335 YIEFFDVRKAKVALQGLNGLEVAGRQLKL 363 >At4g25110.1 68417.m03612 latex-abundant family protein (AMC2) / caspase family protein contains similarity to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam profile PF00656: ICE-like protease (caspase) p20 domain Length = 418 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 217 FPYLSNSRSRSSFLIPSTRPPTYTRVP 137 FP+ ++S + S+F+ P P YT P Sbjct: 49 FPFPNSSPAPSTFIYPPPTPSPYTHAP 75 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKL 221 T+V+VGGL KE + F KYG + Sbjct: 17 TKVFVGGLAWDTHKEAMYDHFIKYGDI 43 >At1g73130.1 68414.m08456 expressed protein Length = 646 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 215 KTKLSLGSTKSPRFAFIEFENLQEAEDACSAMNG 316 ++ L L S++ PRF ++ E+ + AED S + G Sbjct: 31 QSTLCLKSSEPPRFEYVRGESKEVAEDHSSNVQG 64 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 141 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGSLS 263 ++++VGGL E L+ F +GK+ V L+ LS Sbjct: 36 SKIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLS 76 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +3 Query: 147 VYVGGLVEGIKKEDLEREFDKYGKLNSV 230 +YVGGL I ++D+ +F +G++ S+ Sbjct: 230 LYVGGLNSRILEQDIRDQFYAHGEIESI 257 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,744,462 Number of Sequences: 28952 Number of extensions: 160620 Number of successful extensions: 760 Number of sequences better than 10.0: 119 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -