BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20434 (677 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF417489-1|AAN32667.1| 1445|Homo sapiens tensin 3 protein. 33 1.2 AF378756-1|AAL11993.1| 1205|Homo sapiens tumor endothelial marke... 33 1.2 AC073341-1|AAQ96841.1| 1205|Homo sapiens unknown protein. 33 1.2 AB208995-1|BAD92232.1| 1271|Homo sapiens Tensin 3 variant protein. 33 1.2 AY424441-1|AAR02915.1| 82|Homo sapiens immunoglobulin lambda l... 30 8.7 >AF417489-1|AAN32667.1| 1445|Homo sapiens tensin 3 protein. Length = 1445 Score = 32.7 bits (71), Expect = 1.2 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +3 Query: 114 RRGGSGQVSYKLEQALNLWGESSMGVSCPERQGCSAEVSGTRHV 245 RRG S Q +L+Q L+ +G G S E ++ SGTRHV Sbjct: 414 RRGLSAQEKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHV 457 >AF378756-1|AAL11993.1| 1205|Homo sapiens tumor endothelial marker 6 protein. Length = 1205 Score = 32.7 bits (71), Expect = 1.2 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +3 Query: 114 RRGGSGQVSYKLEQALNLWGESSMGVSCPERQGCSAEVSGTRHV 245 RRG S Q +L+Q L+ +G G S E ++ SGTRHV Sbjct: 174 RRGLSAQEKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHV 217 >AC073341-1|AAQ96841.1| 1205|Homo sapiens unknown protein. Length = 1205 Score = 32.7 bits (71), Expect = 1.2 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +3 Query: 114 RRGGSGQVSYKLEQALNLWGESSMGVSCPERQGCSAEVSGTRHV 245 RRG S Q +L+Q L+ +G G S E ++ SGTRHV Sbjct: 174 RRGLSAQEKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHV 217 >AB208995-1|BAD92232.1| 1271|Homo sapiens Tensin 3 variant protein. Length = 1271 Score = 32.7 bits (71), Expect = 1.2 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +3 Query: 114 RRGGSGQVSYKLEQALNLWGESSMGVSCPERQGCSAEVSGTRHV 245 RRG S Q +L+Q L+ +G G S E ++ SGTRHV Sbjct: 524 RRGLSAQEKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHV 567 >AY424441-1|AAR02915.1| 82|Homo sapiens immunoglobulin lambda light chain variable region protein. Length = 82 Score = 29.9 bits (64), Expect = 8.7 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 474 PENASGICAGRATSYCVS-LLTDDEARR-CACWQSGPSG 584 P+ SG +G + S +S L ++DEA CA W PSG Sbjct: 41 PDRFSGSKSGASASLAISGLRSEDEADYYCAAWDDSPSG 79 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,824,771 Number of Sequences: 237096 Number of extensions: 2077247 Number of successful extensions: 7153 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7150 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7671262118 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -