BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20434 (677 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39500.1 68418.m04783 pattern formation protein, putative sim... 27 8.6 At4g28570.1 68417.m04087 alcohol oxidase-related low similarity ... 27 8.6 >At5g39500.1 68418.m04783 pattern formation protein, putative similar to SP|Q42510 Pattern formation protein EMB30 {Arabidopsis thaliana}; contains Pfam profile PF01369: Sec7 domain Length = 1443 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 67 TKPPNRTVSSCIFCDVGAAEAV-RSRINWNKRSICGENRVWECHALSVKVARRR 225 +KP V+S I ++GA AV R + W R I ++++ S+K R++ Sbjct: 22 SKPSKGAVASMINSEIGAVLAVMRRNVRWGVRYIADDDQLEHSLIHSLKELRKQ 75 >At4g28570.1 68417.m04087 alcohol oxidase-related low similarity to long chain fatty alcohol oxidase from Candida cloacae [GI:6983581], Candida tropicalis [GI:6983594] Length = 748 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 398 CMTSSMPFVIKFCQTPA**ATQFLRECHMESG 303 C+ S PFV+KF Q P LR +SG Sbjct: 108 CLDKSWPFVLKFSQLPLDKREAILRNWSRQSG 139 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,884,767 Number of Sequences: 28952 Number of extensions: 293579 Number of successful extensions: 746 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -