BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20432 (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosacc... 27 2.8 SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr ... 26 6.6 >SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1310 Score = 27.1 bits (57), Expect = 2.8 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +3 Query: 234 SLKSVSA*ELHHLRFEESSRPRYPAA--HLHVHGIPSSGSEFAADPTAHQQP 383 SL S E HLR +ES + P+ L +PS S + T HQQP Sbjct: 759 SLPSQQTTETKHLR-KESIPSKQPSGGQQLRQESLPSQQSSESKQSTQHQQP 809 >SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 25.8 bits (54), Expect = 6.6 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -1 Query: 169 HHVVVHNSLPTYNCVLGEINLELNFNGVLVLALQ 68 H V+ NS+ ++ + +ELN++ V V L+ Sbjct: 239 HESVLRNSMDDFHTAISSSEIELNYSNVSVSTLK 272 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,679,066 Number of Sequences: 5004 Number of extensions: 50981 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -