BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20432 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 25 3.3 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 25 3.3 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 4.3 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 4.3 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 4.3 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 4.3 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 4.3 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 4.3 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 5.7 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 23 7.6 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 23 7.6 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 7.6 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA++ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIQHVGSVHAAP 53 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA+ G +HAAP Sbjct: 26 GSIASSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA++ G +HAAP Sbjct: 26 GSIATSHSTIQHHARPAIQHVGSIHAAP 53 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSSIQHHAAPAIHHVGSIHAAP 53 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.4 bits (48), Expect = 7.6 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 344 ARTWNPMNMKVRSRVARSG-RLFKTQMMQLLSRDALQRNPGAA 219 A + +N K + ARS ++FK +++L + L+RN G A Sbjct: 453 ASNYKTLNYKAQKAAARSHVKIFKA-LVRLRKQRTLRRNDGNA 494 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +1 Query: 418 NFIHKQSFFSGEKLTKKNNFLIFSTKIIVFFRMATLDYPRL 540 +++ + +F+GE LT + L+ + V + +YPRL Sbjct: 143 HYLTRNDYFAGENLTIADLSLVPTIASAVHCGLDLTNYPRL 183 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 7.6 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 145 GCCAQQHDVPPRARGPAVRQQGQLHAAP 228 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSSIQHHAAPAIHHVGSVHAAP 53 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,983 Number of Sequences: 2352 Number of extensions: 12706 Number of successful extensions: 52 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -