BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20432 (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.3 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 4.0 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 5.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 7.0 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 7.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 7.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.3 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = +1 Query: 265 IICVLKSRPDRATLLRTFMFMGFQVLAPNSPLTPQHINNPNYIFLHY 405 I+C + S + + F +GF P+ ++ P FL Y Sbjct: 317 IVCTVNSCTSMLSGIVIFSVVGFMAHEQQKPVADVAVSGPGLAFLVY 363 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 326 MNMKVRSRVARSGRLFKTQMMQLL 255 ++MK++ V +SGR+ TQ + L Sbjct: 353 VSMKIKQNVPQSGRVNNTQRNEYL 376 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 160 VVHNSLPTYNCVLGEINL 107 +V S+PTY C LG+ L Sbjct: 649 LVATSMPTYICYLGKAYL 666 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 7.0 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 441 LLG*ETNKKKQLSHFFHKNNRVFSYGNIRLSTTRSSQALR 560 L G E + L + +NN + GN+ RS + LR Sbjct: 857 LKGFEFERLSHLRELYLQNNLIGFIGNLTFLPLRSLEILR 896 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 6 RVMAKRLRNSYNYNN 50 R + L N+YNYNN Sbjct: 312 RKIISSLSNNYNYNN 326 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/47 (23%), Positives = 18/47 (38%) Frame = +1 Query: 265 IICVLKSRPDRATLLRTFMFMGFQVLAPNSPLTPQHINNPNYIFLHY 405 I+C + S + + F +GF P+ + P FL Y Sbjct: 370 IVCTVNSCTSMLSGIVIFSVVGFMAHEQQKPVADVAASGPGLAFLVY 416 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -1 Query: 226 EQHEAVLAAGLQDPGHAEVHHVVVHNSL 143 E+H+ VL ++ G+ + NSL Sbjct: 190 EEHDTVLVVNIEKSGNESKKYATSSNSL 217 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,832 Number of Sequences: 438 Number of extensions: 3506 Number of successful extensions: 64 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -