BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20431 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35532| Best HMM Match : Peptidase_S49 (HMM E-Value=2.7) 31 1.1 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) 30 2.4 SB_56545| Best HMM Match : Exonuc_X-T (HMM E-Value=1.2e-09) 29 4.3 SB_37350| Best HMM Match : MFS_1 (HMM E-Value=4.9e-07) 29 5.6 SB_49487| Best HMM Match : Zip (HMM E-Value=0.014) 28 7.5 SB_39673| Best HMM Match : TRAP-delta (HMM E-Value=1.2e-32) 28 9.9 SB_44903| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_35532| Best HMM Match : Peptidase_S49 (HMM E-Value=2.7) Length = 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/74 (28%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Frame = +1 Query: 49 RSSIPDKVPEAEDKPLNVVDNLSSEQELIDQ-ANTIKDIDNSLRANKKEVIDIPVKVIVE 225 + SIP P+ + K LN V+N++ +E ++ A+ + D+ N + + K E V V+ Sbjct: 72 KDSIPLAKPQKQQKVLNAVENINWPEEKKERFADVLNDVHN-ISSEKSEEEGDGVVFFVK 130 Query: 226 EIKPSLKSDLKTLK 267 +K + +++L+ LK Sbjct: 131 SLKWA-RNELRILK 143 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/84 (26%), Positives = 46/84 (54%) Frame = +1 Query: 34 RARRTRSSIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVK 213 R R+ ++ +KV E+ D + ++N EL +Q IK+ + L+ +KE+ + K Sbjct: 593 RDRQIQNLSLEKVNESRDDEITELEN-----ELEEQREIIKENEEKLKEKEKEIEKLKKK 647 Query: 214 VIVEEIKPSLKSDLKTLKCRMKMR 285 +I E+ LK D++T + +++ + Sbjct: 648 II--ELSDKLK-DMETSRNKVETK 668 >SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = +3 Query: 318 PGPPQHQEHETQNPEHHEDAEKIVSSVKN---DINTAEIALRQGFQEVSDGIGKWYARTE 488 P PP H + E H E E+I S K+ D+ A+ L++ +++ + +G Y R Sbjct: 282 PNPPPHLDEEKIKQLHEELKEEIKSMAKDSEKDLEDAKKDLKEEIEQIKEEVG--YLRYM 339 Query: 489 QINEL 503 + +L Sbjct: 340 EAKQL 344 >SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) Length = 458 Score = 29.9 bits (64), Expect = 2.4 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 3/85 (3%) Frame = +1 Query: 37 ARRTRSSIPDKVPEAEDKPLNVVDNL--SSEQELIDQANTIKDIDNSLRANKKEVIDIPV 210 A R+R D +A L + + SS ++LID I+D ++S +KE + + Sbjct: 124 AMRSRGDTTDAEIKALKTQLKMAEETRDSSRRDLIDAHRKIRDAEDSKETLRKENLHVKR 183 Query: 211 KV-IVEEIKPSLKSDLKTLKCRMKM 282 +V +E K SL+ + L+ ++K+ Sbjct: 184 QVKDLEMEKQSLEKSVSDLREKVKL 208 >SB_56545| Best HMM Match : Exonuc_X-T (HMM E-Value=1.2e-09) Length = 416 Score = 29.1 bits (62), Expect = 4.3 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%) Frame = +1 Query: 145 NTIKDIDNS--LRANKKEVIDIPVKVIVEEIKPSLKSDLKTLKCRMKMRKSRGL*SI*EI 318 N +K + +S +++ K + D+PV +EE D ++ K RGL ++ + Sbjct: 315 NFMKQMKHSQEVKSRKDTLCDLPVSSSMEEKIAKSGMDFNKMRSVYKEGGERGLLTVLAL 374 Query: 319 PGPRS---IKSTKHRILNTTKMLKK 384 P S +K +K R+ T +++ K Sbjct: 375 PPQYSQLNVKGSKPRVTKTIRIINK 399 >SB_37350| Best HMM Match : MFS_1 (HMM E-Value=4.9e-07) Length = 349 Score = 28.7 bits (61), Expect = 5.6 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = -1 Query: 230 ISSTITLTGMSMTSFLFARRLL-SMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGME 54 IS ++ GM+ SFLFA LL + + + S L LS GL + +G+ + ++ Sbjct: 255 ISRSVVRKGMTFLSFLFAATLLVPVGFLNCSQQNISVLLLTLSCGSLGLYAPTGSANSVD 314 Query: 53 LRVRRARI*LA 21 L R A + +A Sbjct: 315 LSPRFAGVTMA 325 >SB_49487| Best HMM Match : Zip (HMM E-Value=0.014) Length = 510 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +3 Query: 333 HQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGI 464 HQ H + HH D +KI S + + GF +SDG+ Sbjct: 73 HQNHHDHHHHHHHD-KKIDSKTSIATVAWMVIVSDGFHNLSDGL 115 >SB_39673| Best HMM Match : TRAP-delta (HMM E-Value=1.2e-32) Length = 504 Score = 27.9 bits (59), Expect = 9.9 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +2 Query: 524 QENFGAQIQKLNETLHFIKPADTIAAPSVEETQNKASFETIESGLK--SLETNFNSGLNQ 697 QEN QI LNE L + T A E QN T + +K S+ ++ NS Sbjct: 134 QENAQKQINHLNELLTTLTDIITSAKEDWEGEQNSVGLLTCGAQVKAPSVNSSSNSPDES 193 Query: 698 LSEGIQIVAT 727 + E I + T Sbjct: 194 VIEAINVFVT 203 >SB_44903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1281 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 620 QNKASFETIESGLKSLET-NFNSGLNQLSEGIQIVATFKADGEAAAESSVPPCSKH 784 +NK S T S K E + + + +E Q+V A+ + A E VP C KH Sbjct: 767 ENKLSSYTDNSQHKGFELPSTDHSACRATEHAQVVEPSHANMQVAGEEHVPTCRKH 822 >SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 540 APKFSWKCCKLPGAR*FARYERTIFQYRLTLPGSLDE 430 AP+ WKC KL G R ++ F++ L LDE Sbjct: 74 APEQFWKCFKLWGQPVNVREQQDAFEFFCNLTDQLDE 110 >SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 540 APKFSWKCCKLPGAR*FARYERTIFQYRLTLPGSLDE 430 AP+ WKC KL G R ++ F++ L LDE Sbjct: 66 APEQFWKCFKLWGQPVNVREQQDAFEFFCNLTDQLDE 102 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,429,793 Number of Sequences: 59808 Number of extensions: 375879 Number of successful extensions: 1364 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1357 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -