BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20429 (577 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49814-1|CAA89968.1| 137|Anopheles gambiae serine proteinase pr... 25 1.3 AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 25 1.8 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 23 9.4 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 23 9.4 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 9.4 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 9.4 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 23 9.4 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 23 9.4 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 23 9.4 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 23 9.4 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 9.4 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 9.4 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 23 9.4 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 23 9.4 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 23 9.4 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 23 9.4 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 23 9.4 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 23 9.4 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 23 9.4 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 23 9.4 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 23 9.4 >Z49814-1|CAA89968.1| 137|Anopheles gambiae serine proteinase protein. Length = 137 Score = 25.4 bits (53), Expect = 1.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 350 LLGVNFCFFIGIILFGAPVLD 412 LLG F F +G++ FG P ++ Sbjct: 53 LLGNIFSFIVGVVSFGTPCVE 73 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 391 KYYSNKETKVNT*EKHKRFEDVACFRFTGLAFLSLYIIR 275 + +S E++ K+ F+D+ F G AFL ++ R Sbjct: 44 RVHSPAESEGGNLRKYPHFQDIHVMIFAGFAFLMTFLKR 82 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 59 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 91 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 59 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 91 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 61 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 93 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 61 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 93 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 64 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 96 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 64 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 96 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 74 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 106 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 76 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 108 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 76 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 108 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 58 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 90 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 58 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 90 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 101 LSIKRKHFSVSIILFITNTIYCLTFKLSVCFSC 3 LSI K++ +I+ +T + F CF+C Sbjct: 73 LSITTKYYETNIVPKSRHTPQIIMFYADWCFAC 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 542,518 Number of Sequences: 2352 Number of extensions: 10461 Number of successful extensions: 69 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -