BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20429 (577 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81043-5|CAB02802.2| 278|Caenorhabditis elegans Hypothetical pr... 29 2.4 AF016450-5|AAB65984.2| 280|Caenorhabditis elegans Serpentine re... 27 7.2 >Z81043-5|CAB02802.2| 278|Caenorhabditis elegans Hypothetical protein C29F3.6 protein. Length = 278 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +1 Query: 367 LFLYWNNTFWRACIRLT*RNIDVIHALNYTHNISPHTSFWCGMFYATMFGVK 522 +FL+ N F + ++ V+ ++ +++ S WC +FY TMF +K Sbjct: 73 VFLFQENVFIFGFLVAVFHDVSVL--THFIISLNRFISVWCPIFYKTMFNLK 122 >AF016450-5|AAB65984.2| 280|Caenorhabditis elegans Serpentine receptor, class t protein68 protein. Length = 280 Score = 27.5 bits (58), Expect = 7.2 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 4/75 (5%) Frame = +3 Query: 75 TKMFAFNTQLELRRITISSLITCIYLPS---IVTVISYRGSLYYVGKGSSFYILVLIF-I 242 T +F FN E+ RI I + I++P IV ++Y I+VL F + Sbjct: 7 TSIFTFNEDPEMLRIGIIYFLFTIFIPPLLIIVIKVTYINDRRAPNFPYKLMIIVLTFQL 66 Query: 243 AELLSRFILAPRMIY 287 + FI +P +++ Sbjct: 67 LQSTGHFITSPVLVF 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,879,927 Number of Sequences: 27780 Number of extensions: 227103 Number of successful extensions: 577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1194789454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -