BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20422 (773 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 30 0.069 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 30 0.069 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 30 0.069 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 28 0.37 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 27 0.64 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 25 2.6 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 3.4 AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 24 6.0 AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine p... 24 6.0 AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine p... 24 6.0 AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine p... 24 6.0 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 24 6.0 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 7.9 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 30.3 bits (65), Expect = 0.069 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -2 Query: 208 VGLIIFLYDELFVLQSC--FLFRSISARGRFRQVWAWWSHDFVWLQVAA 68 VGL+ L + ++Q+ FLFR ++ R+V++WW+ V +Q A Sbjct: 9 VGLVADLMPNIRLMQASGHFLFRYVTGPILIRKVYSWWTLAMVLIQFFA 57 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 30.3 bits (65), Expect = 0.069 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -2 Query: 208 VGLIIFLYDELFVLQSC--FLFRSISARGRFRQVWAWWSHDFVWLQVAA 68 VGL+ L + ++Q+ FLFR ++ R+V++WW+ V +Q A Sbjct: 9 VGLVADLMPNIRLMQASGHFLFRYVTGPILIRKVYSWWTLAMVLIQFFA 57 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 30.3 bits (65), Expect = 0.069 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -1 Query: 80 PGSCCVCGVPGAPGAEGRNG 21 PG+ V GVPGAPG GR+G Sbjct: 162 PGTNGVPGVPGAPGLAGRDG 181 Score = 26.2 bits (55), Expect = 1.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 80 PGSCCVCGVPGAPGAEGRNG 21 PG + G PGAPG +G G Sbjct: 705 PGEAGIDGAPGAPGKDGLPG 724 Score = 24.2 bits (50), Expect = 4.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 10 RGPAPLRPSAPGAPGTPQTQQLPGAKQNR 96 R AP P G G P LPGAK R Sbjct: 542 RPGAPGLPGRDGEKGEPGRPGLPGAKGER 570 Score = 23.8 bits (49), Expect = 6.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 80 PGSCCVCGVPGAPGAEGRNG 21 PG GVPG PGA G G Sbjct: 159 PGIPGTNGVPGVPGAPGLAG 178 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 80 PGSCCVCGVPGAPGAEGRNG 21 PG GVPG PG G G Sbjct: 252 PGRPGEKGVPGTPGVRGERG 271 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 59 GVPGAPGAEGRNG 21 G+PG PG GR+G Sbjct: 341 GLPGQPGPRGRDG 353 Score = 23.8 bits (49), Expect = 6.0 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 59 GVPGAPGAEGRNG 21 G PGAPG GR+G Sbjct: 541 GRPGAPGLPGRDG 553 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 28 RPSAPGAPGTPQTQQLPG 81 R PG PG P T +PG Sbjct: 152 RDGLPGYPGIPGTNGVPG 169 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -1 Query: 59 GVPGAPGAEGRNG 21 GVPG PG EG G Sbjct: 450 GVPGRPGPEGMPG 462 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 27.9 bits (59), Expect = 0.37 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 10 RGPAPLRPSAPGAPGTPQTQQLPGAK 87 +GPA P APG PG + LPG K Sbjct: 166 KGPAG-HPGAPGRPGVDGVKGLPGLK 190 Score = 27.5 bits (58), Expect = 0.49 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 80 PGSCCVCGVPGAPGAEGRNG 21 PG G+PGAPGA G G Sbjct: 733 PGLAGPAGIPGAPGAPGEMG 752 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 80 PGSCCVCGVPGAPGAEGRNG 21 PG CV G+PGA G G G Sbjct: 399 PGPPCVDGLPGAAGPVGPRG 418 Score = 25.8 bits (54), Expect = 1.5 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 19 APLRPSAPGAPGTPQTQQLPGAKQNRVTTMPKPVG 123 AP R PGAPG P ++ + G + P P G Sbjct: 76 APGRDGMPGAPGLPGSKGVKGDPGLSMVGPPGPKG 110 Score = 25.0 bits (52), Expect = 2.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 31 PSAPGAPGTPQTQQLPGAK 87 P APG G P LPG+K Sbjct: 74 PGAPGRDGMPGAPGLPGSK 92 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 83 APGSCCVCGVPGAPGAEGRNG 21 A G + G+PG PG G NG Sbjct: 504 AKGEMGIQGLPGLPGPAGLNG 524 Score = 24.6 bits (51), Expect = 3.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 13 GPAPLRPSAPGAPGTPQTQQLPGAK 87 GPA + P APGAPG + GA+ Sbjct: 737 GPAGI-PGAPGAPGEMGLRGFEGAR 760 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 83 APGSCCVCGVPGAPGAEGRNG 21 APG + G PG PG++G G Sbjct: 76 APGRDGMPGAPGLPGSKGVKG 96 Score = 23.8 bits (49), Expect = 6.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 83 APGSCCVCGVPGAPGAEGRNGA 18 APG V GV G PG +G GA Sbjct: 174 APGRPGVDGVKGLPGLKGDIGA 195 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 59 GVPGAPGAEGRNGA 18 G PGAPG +G GA Sbjct: 72 GPPGAPGRDGMPGA 85 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 80 PGSCCVCGVPGAPGAEGRNG 21 PG+ G+PGAPG G G Sbjct: 74 PGAPGRDGMPGAPGLPGSKG 93 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 59 GVPGAPGAEGRNG 21 G+PG PG GR+G Sbjct: 550 GLPGRPGKTGRDG 562 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 27.1 bits (57), Expect = 0.64 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 280 WKLITRSALARFELVTEGRQAYWR 209 W+++ RS A VTE +QAY+R Sbjct: 322 WRVLLRSKTAVIFAVTEAQQAYYR 345 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 25.0 bits (52), Expect = 2.6 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 225 RPSVTSSNRARALRVINFQKQLRSEILGQVRRDTTLETAVNIKAY--KRTKRQGLR 386 RP T NR + V +F ++ ++ Q+R +E +N K + +RT + LR Sbjct: 235 RPQTTRPNRQDIIEVTSFTGKMWYQVYKQIREAPEME-KMNEKLHIGRRTAKLNLR 289 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.6 bits (51), Expect = 3.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 366 CAYRPLCLQRSLG 328 C+YRPLC+ +LG Sbjct: 488 CSYRPLCMLDALG 500 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGATNGSLPNGTAVKENRSKWDEYCEGL 96 >AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 69 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 98 >AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 69 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 98 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +3 Query: 624 AVNGRRRRRLP*TDSIKRKTKDWRSYCHRL 713 A NG LP ++K W YC L Sbjct: 67 ATNGAANGSLPNGTAVKENRSKWDEYCEGL 96 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 680 DKRLAFLLSQTDEYIASLTEMVKQHK 757 +KR+ +L+ T+E L+E +KQ K Sbjct: 870 EKRIKKVLTDTEEVDRKLSEALKQQK 895 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,476 Number of Sequences: 2352 Number of extensions: 13189 Number of successful extensions: 163 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -