BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20421 (564 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schi... 29 0.36 SPAC13G6.08 |||Cdc20/Fizzy family WD repeat protein|Schizosaccha... 25 5.8 >SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 29.5 bits (63), Expect = 0.36 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 345 TLMYNVNIIVDVDMKKPTYR*RKTN-RFVYIFVDVIPIYLF*CILDEVLI 491 T MY +NI +DV ++ R + N ++ VIP+ F IL +L+ Sbjct: 258 TFMYTLNIRIDVPIRSSRVRGVRQNFPLKLLYTSVIPLIYFYSILSHLLV 307 >SPAC13G6.08 |||Cdc20/Fizzy family WD repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 535 Score = 25.4 bits (53), Expect = 5.8 Identities = 15/59 (25%), Positives = 24/59 (40%) Frame = -2 Query: 536 TFRKNFFRLAPFTTRDKNFVQYTSK*VNRYYVNKDVNKSVSFTLSVRGFLHINVDDNIY 360 T R R P T+ ++R VNK N S ++ + L + DDN++ Sbjct: 80 TSRNGLDRFIPMTSNKDTISLGRHSSLSRNLVNKTKNASETYQQLLEYALEVERDDNVF 138 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,034,253 Number of Sequences: 5004 Number of extensions: 37594 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -