BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20421 (564 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56686| Best HMM Match : Cadherin (HMM E-Value=0) 29 2.6 SB_32366| Best HMM Match : Kinesin (HMM E-Value=0) 29 3.5 >SB_56686| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1888 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 431 VNKSVSFTLSVRGFLHINVDDN 366 V K ++FTL R FLHIN+ D+ Sbjct: 461 VGKKLNFTLYPRYFLHINISDS 482 >SB_32366| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1492 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = -2 Query: 563 MTDLKSVVTTFRKNFFRLAPFTTRDKNFVQYTSK*VNRYYVN---KDVNKSVSFTLS 402 +TDL + T F K F+ DKN++ TS+ + YY N K+++K TL+ Sbjct: 1318 ITDLYGMTTVFWKRFYAALDKYDIDKNWLSSTSQFIT-YYQNSKKKNIDKQDKRTLA 1373 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,406,077 Number of Sequences: 59808 Number of extensions: 253516 Number of successful extensions: 398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -