BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20421 (564 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069719-1|AAL39864.1| 1136|Drosophila melanogaster LP02352p pro... 28 7.6 AE014297-3136|AAF55981.2| 1136|Drosophila melanogaster CG18596-P... 28 7.6 >AY069719-1|AAL39864.1| 1136|Drosophila melanogaster LP02352p protein. Length = 1136 Score = 28.3 bits (60), Expect = 7.6 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 11 DNNLIVINFVLDNFLSH-CFRQLLNFQYLTK 100 DNN++V+ + L FLSH Q+ F LT+ Sbjct: 262 DNNILVLRWTLKYFLSHFSLEQISRFNLLTQ 292 >AE014297-3136|AAF55981.2| 1136|Drosophila melanogaster CG18596-PA protein. Length = 1136 Score = 28.3 bits (60), Expect = 7.6 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 11 DNNLIVINFVLDNFLSH-CFRQLLNFQYLTK 100 DNN++V+ + L FLSH Q+ F LT+ Sbjct: 262 DNNILVLRWTLKYFLSHFSLEQISRFNLLTQ 292 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,010,402 Number of Sequences: 53049 Number of extensions: 350949 Number of successful extensions: 554 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2193288294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -