BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20418 (752 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 23 4.1 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 5.4 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 21 9.4 X72576-1|CAA51168.1| 144|Apis mellifera Apidaecin precursor pro... 21 9.4 AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor p... 21 9.4 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 98 PKPAPVTPKFTAKVEPKA 45 P+P P P+ + EPKA Sbjct: 51 PQPRPPHPRLRREAEPKA 68 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 5.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 146 NPQPWSEEA 120 NP PWSE+A Sbjct: 568 NPTPWSEDA 576 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -1 Query: 140 QPWSEEATSAQRPEPKPAPVTPKFTAKVEPKA 45 +P +E + P+P P P+ + EP+A Sbjct: 176 EPEAEPGNNRPVYIPQPRPPHPRLRREAEPEA 207 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -1 Query: 140 QPWSEEATSAQRPEPKPAPVTPKFTAKVEPKA 45 +P +E + P+P P P+ + EP+A Sbjct: 204 EPEAEPGNNRPVYIPQPRPPHPRLRREAEPEA 235 >X72576-1|CAA51168.1| 144|Apis mellifera Apidaecin precursor protein. Length = 144 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -1 Query: 140 QPWSEEATSAQRPEPKPAPVTPKFTAKVEPKA 45 +P +E + P+P P P+ + EP+A Sbjct: 37 EPEAEPGNNRPVYIPQPRPPHPRLRREAEPEA 68 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -1 Query: 140 QPWSEEATSAQRPEPKPAPVTPKFTAKVEPKA 45 +P +E + P+P P P+ + EP+A Sbjct: 65 EPEAEPGNNRPVYIPQPRPPHPRLRREAEPEA 96 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -1 Query: 140 QPWSEEATSAQRPEPKPAPVTPKFTAKVEPKA 45 +P +E + P+P P P+ + EP+A Sbjct: 93 EPEAEPGNNRPVYIPQPRPPHPRLRREAEPEA 124 >AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor protein. Length = 199 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -1 Query: 140 QPWSEEATSAQRPEPKPAPVTPKFTAKVEPKA 45 +P +E + P+P P P+ + EP+A Sbjct: 36 EPEAEPGNNRPVYIPQPRPPHPRLRREAEPEA 67 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -1 Query: 140 QPWSEEATSAQRPEPKPAPVTPKFTAKVEPKA 45 +P +E + P+P P P+ + EP+A Sbjct: 64 EPEAEPGNNRPVYIPQPRPPHPRLRREAEPEA 95 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -1 Query: 140 QPWSEEATSAQRPEPKPAPVTPKFTAKVEPKA 45 +P +E + P+P P P+ + EP+A Sbjct: 92 EPEAEPGNNRPVYIPQPRPPHPRLRREAEPEA 123 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,092 Number of Sequences: 438 Number of extensions: 5321 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -