BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20416 (377 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC062370-1|AAH62370.1| 125|Homo sapiens brain protein I3 protein. 38 0.011 BC018737-1|AAH18737.1| 125|Homo sapiens brain protein I3 protein. 38 0.011 AF106966-1|AAD05167.1| 125|Homo sapiens I3 protein protein. 38 0.011 AF041430-1|AAF18565.2| 125|Homo sapiens pRGR2 protein. 38 0.011 AB055977-1|BAB32785.1| 125|Homo sapiens I3 protein protein. 38 0.011 M17653-1|AAA60634.1| 109|Homo sapiens TCRA protein. 30 2.2 AK024458-1|BAB15748.1| 270|Homo sapiens FLJ00050 protein protein. 29 3.8 X08006-1|CAA30807.1| 497|Homo sapiens cytochrome P450 db1 protein. 29 5.0 M20403-1|AAA52153.1| 497|Homo sapiens CYP2D protein. 29 5.0 U80457-1|AAB62397.1| 570|Homo sapiens transcription factor SIM2... 29 6.6 U80456-1|AAB62396.1| 667|Homo sapiens transcription factor SIM2... 29 6.6 BC150262-1|AAI50263.1| 1516|Homo sapiens RUN and SH3 domain cont... 29 6.6 BC146654-1|AAI46655.1| 1516|Homo sapiens RUSC2 protein protein. 29 6.6 BC132770-1|AAI32771.1| 1516|Homo sapiens RUN and SH3 domain cont... 29 6.6 BC132766-1|AAI32767.1| 1516|Homo sapiens RUN and SH3 domain cont... 29 6.6 BC110444-1|AAI10445.1| 570|Homo sapiens single-minded homolog 2... 29 6.6 BC064843-1|AAH64843.1| 1301|Homo sapiens RUSC2 protein protein. 29 6.6 AP000697-1|BAA89433.1| 667|Homo sapiens single-minded 2 protein... 29 6.6 AL133476-3|CAH70650.1| 1516|Homo sapiens RUN and SH3 domain cont... 29 6.6 AJ001858-1|CAA05055.1| 463|Homo sapiens human SIM2 protein. 29 6.6 AB003185-2|BAA21490.1| 181|Homo sapiens SIM2s protein. 29 6.6 AB003185-1|BAA21489.1| 278|Homo sapiens SIM2 protein. 29 6.6 AB002373-1|BAA20830.2| 1540|Homo sapiens KIAA0375 protein protein. 29 6.6 >BC062370-1|AAH62370.1| 125|Homo sapiens brain protein I3 protein. Length = 125 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +3 Query: 318 VGACPACRVGILEDDFTCLG 377 VG CP CRVG+LED FT LG Sbjct: 75 VGGCPVCRVGVLEDCFTFLG 94 >BC018737-1|AAH18737.1| 125|Homo sapiens brain protein I3 protein. Length = 125 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +3 Query: 318 VGACPACRVGILEDDFTCLG 377 VG CP CRVG+LED FT LG Sbjct: 75 VGGCPVCRVGVLEDCFTFLG 94 >AF106966-1|AAD05167.1| 125|Homo sapiens I3 protein protein. Length = 125 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +3 Query: 318 VGACPACRVGILEDDFTCLG 377 VG CP CRVG+LED FT LG Sbjct: 75 VGGCPVCRVGVLEDCFTFLG 94 >AF041430-1|AAF18565.2| 125|Homo sapiens pRGR2 protein. Length = 125 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +3 Query: 318 VGACPACRVGILEDDFTCLG 377 VG CP CRVG+LED FT LG Sbjct: 75 VGGCPVCRVGVLEDCFTFLG 94 >AB055977-1|BAB32785.1| 125|Homo sapiens I3 protein protein. Length = 125 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +3 Query: 318 VGACPACRVGILEDDFTCLG 377 VG CP CRVG+LED FT LG Sbjct: 75 VGGCPVCRVGVLEDCFTFLG 94 >M17653-1|AAA60634.1| 109|Homo sapiens TCRA protein. Length = 109 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 190 DACGYVCG*SPGGTAAEYGGGCSVTVGFSIK 98 D+ Y+C PGGTA +G G +++V +I+ Sbjct: 77 DSATYLCAPKPGGTALIFGKGTTLSVSSNIQ 107 >AK024458-1|BAB15748.1| 270|Homo sapiens FLJ00050 protein protein. Length = 270 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 185 LWVCMRLKPWRDCRRIRRGLLGH 117 LWV R+K W C +R GL+ H Sbjct: 221 LWVAQRIKMWPPCFPVRSGLVLH 243 >X08006-1|CAA30807.1| 497|Homo sapiens cytochrome P450 db1 protein. Length = 497 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 267 KPVSEEEHHMDYTPEVVAEKVHLGD*MPVGM 175 +P ++ HM YT V+ E GD +P+GM Sbjct: 344 RPEMGDQAHMPYTTAVIHEVQRFGDIVPLGM 374 >M20403-1|AAA52153.1| 497|Homo sapiens CYP2D protein. Length = 497 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 267 KPVSEEEHHMDYTPEVVAEKVHLGD*MPVGM 175 +P ++ HM YT V+ E GD +P+GM Sbjct: 344 RPEMGDQAHMPYTTAVIHEVQRFGDIVPLGM 374 >U80457-1|AAB62397.1| 570|Homo sapiens transcription factor SIM2 short form protein. Length = 570 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 132 PPYSAAVPPGLQPHT 176 PP SAA PP LQPH+ Sbjct: 411 PPASAAAPPELQPHS 425 >U80456-1|AAB62396.1| 667|Homo sapiens transcription factor SIM2 long form protein. Length = 667 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 132 PPYSAAVPPGLQPHT 176 PP SAA PP LQPH+ Sbjct: 411 PPASAAAPPELQPHS 425 >BC150262-1|AAI50263.1| 1516|Homo sapiens RUN and SH3 domain containing 2 protein. Length = 1516 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 105 EKPTVTEQPPPYSAAVPPGLQPHT 176 E+PT TE PP+S + P ++P T Sbjct: 806 EQPTATESLPPWSHSCPSAVRPAT 829 >BC146654-1|AAI46655.1| 1516|Homo sapiens RUSC2 protein protein. Length = 1516 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 105 EKPTVTEQPPPYSAAVPPGLQPHT 176 E+PT TE PP+S + P ++P T Sbjct: 806 EQPTATESLPPWSHSCPSAVRPAT 829 >BC132770-1|AAI32771.1| 1516|Homo sapiens RUN and SH3 domain containing 2 protein. Length = 1516 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 105 EKPTVTEQPPPYSAAVPPGLQPHT 176 E+PT TE PP+S + P ++P T Sbjct: 806 EQPTATESLPPWSHSCPSAVRPAT 829 >BC132766-1|AAI32767.1| 1516|Homo sapiens RUN and SH3 domain containing 2 protein. Length = 1516 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 105 EKPTVTEQPPPYSAAVPPGLQPHT 176 E+PT TE PP+S + P ++P T Sbjct: 806 EQPTATESLPPWSHSCPSAVRPAT 829 >BC110444-1|AAI10445.1| 570|Homo sapiens single-minded homolog 2 (Drosophila) protein. Length = 570 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 132 PPYSAAVPPGLQPHT 176 PP SAA PP LQPH+ Sbjct: 411 PPASAAAPPELQPHS 425 >BC064843-1|AAH64843.1| 1301|Homo sapiens RUSC2 protein protein. Length = 1301 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 105 EKPTVTEQPPPYSAAVPPGLQPHT 176 E+PT TE PP+S + P ++P T Sbjct: 591 EQPTATESLPPWSHSCPSAVRPAT 614 >AP000697-1|BAA89433.1| 667|Homo sapiens single-minded 2 protein protein. Length = 667 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 132 PPYSAAVPPGLQPHT 176 PP SAA PP LQPH+ Sbjct: 411 PPASAAAPPELQPHS 425 >AL133476-3|CAH70650.1| 1516|Homo sapiens RUN and SH3 domain containing 2 protein. Length = 1516 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 105 EKPTVTEQPPPYSAAVPPGLQPHT 176 E+PT TE PP+S + P ++P T Sbjct: 806 EQPTATESLPPWSHSCPSAVRPAT 829 >AJ001858-1|CAA05055.1| 463|Homo sapiens human SIM2 protein. Length = 463 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 132 PPYSAAVPPGLQPHT 176 PP SAA PP LQPH+ Sbjct: 348 PPASAAAPPELQPHS 362 >AB003185-2|BAA21490.1| 181|Homo sapiens SIM2s protein. Length = 181 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 132 PPYSAAVPPGLQPHT 176 PP SAA PP LQPH+ Sbjct: 22 PPASAAAPPELQPHS 36 >AB003185-1|BAA21489.1| 278|Homo sapiens SIM2 protein. Length = 278 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 132 PPYSAAVPPGLQPHT 176 PP SAA PP LQPH+ Sbjct: 22 PPASAAAPPELQPHS 36 >AB002373-1|BAA20830.2| 1540|Homo sapiens KIAA0375 protein protein. Length = 1540 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 105 EKPTVTEQPPPYSAAVPPGLQPHT 176 E+PT TE PP+S + P ++P T Sbjct: 830 EQPTATESLPPWSHSCPSAVRPAT 853 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,295,449 Number of Sequences: 237096 Number of extensions: 1270359 Number of successful extensions: 3830 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 3504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3823 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2536788584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -