BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20414 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 25 0.44 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 3.1 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 7.2 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 7.2 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 9.6 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 25.4 bits (53), Expect = 0.44 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 475 RLSCDCILREINILD 431 +L C+CIL+ NILD Sbjct: 60 QLYCECILKNFNILD 74 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 407 SRDVFNSDVQNIDFSKNTVAAKSIND 484 S ++ + QNID +KNT+ ND Sbjct: 410 SMEINQNIAQNIDHAKNTIIDYRNND 435 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 425 SDVQNIDFSKNTVAAKSINDWVEENTNNALR 517 S+++ I S + V W++EN+ AL+ Sbjct: 184 SNIKVISISPDLVETDMTAQWLKENSRLALK 214 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 159 PGKSVVLSAFSVLPPLAQLALASDGET 239 P K + AF PPL + A+ +T Sbjct: 406 PSKPMCAEAFQEFPPLGRFAVRDMRQT 432 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 560 TPAVAELSESGLTKSLMRYW 501 T A+ + ESG +SL +W Sbjct: 780 TLAILDFHESGFMESLDNHW 799 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,623 Number of Sequences: 438 Number of extensions: 3568 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -