BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20413 (479 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 47 3e-04 UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr... 34 1.9 UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12... 32 5.8 UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole... 32 7.7 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 46.8 bits (106), Expect = 3e-04 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = +3 Query: 186 IYGTGGLLTPLVAPVLGFSSAGI 254 IYGTGGLLTP+VAP+LGF SAGI Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGI 39 Score = 36.7 bits (81), Expect = 0.27 Identities = 15/20 (75%), Positives = 20/20 (100%) Frame = +2 Query: 299 LVAGSIVSQLTAAAMVAPTP 358 +VAGS++SQLT+AAM+APTP Sbjct: 55 VVAGSVISQLTSAAMLAPTP 74 >UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical cytosolic protein - Granulobacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) Length = 90 Score = 33.9 bits (74), Expect = 1.9 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 122 QKLKEHGA--SSCISGKRGRRCCNIWHWGSVDSISGSRAR 235 Q L+EHG S ++G+R RC N WH G D + R R Sbjct: 42 QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80 >UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12; Bacilli|Rep: Pyrrolidone-carboxylate peptidase - Bacillus subtilis Length = 215 Score = 32.3 bits (70), Expect = 5.8 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 101 LRIARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDSIS 220 L + R K+KEHG + +S G CN +G +D IS Sbjct: 117 LPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHIS 156 >UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF3766, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 328 Score = 31.9 bits (69), Expect = 7.7 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 231 AREPLMESTDPQCHILQHRRPRLPLMQLE 145 A +PL T+P+ +LQ+RRP+L L L+ Sbjct: 5 AEQPLSLRTEPKLRVLQYRRPKLELQLLK 33 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,279,794 Number of Sequences: 1657284 Number of extensions: 7997854 Number of successful extensions: 18604 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18600 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27290400475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -